KEGG   Thermosediminibacter oceani: Toce_2140Help
Entry
Toce_2140         CDS       T01289                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00020  Citrate cycle (TCA cycle)
toc00620  Pyruvate metabolism
toc00633  Nitrotoluene degradation
toc00640  Propanoate metabolism
toc00650  Butanoate metabolism
toc00680  Methane metabolism
toc00720  Carbon fixation pathways in prokaryotes
toc01100  Metabolic pathways
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01200  Carbon metabolism
Module
toc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_2140
   00020 Citrate cycle (TCA cycle)
    Toce_2140
   00620 Pyruvate metabolism
    Toce_2140
   00640 Propanoate metabolism
    Toce_2140
   00650 Butanoate metabolism
    Toce_2140
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Toce_2140
   00680 Methane metabolism
    Toce_2140
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Toce_2140
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Toce_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_16 Fer4_10 Fer4_2 Fer4_17 Fer4_9 Fer4_15 Fer4_4 Fer4_8 Fer4_13 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADL08854
UniProt: D9S0J6
Position
complement(2145093..2145470)
Genome map
AA seq 125 aa AA seqDB search
MTPYNPFNRNFGTGTRTKAVRPDMKWHELTRAGNIYEPGNANTYETGDWRSRRPVWNKDR
CIHCLMCWRYCPDASVIAKDGKFETFDYKHCKGCGICAKVCPVNAIDMFPEDEIKKVKEA
NKDEN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgtacaacccctttaacagaaatttcggtacaggaaccaggaccaaagccgtg
cgcccggacatgaagtggcacgaactgacccgcgcgggcaacatctacgaacctggcaat
gccaacacctacgagaccggtgactggagatccagaagacccgtgtggaacaaagataga
tgcatacactgccttatgtgctggagatactgccccgatgcttccgtcatagccaaggac
ggcaagtttgagacctttgactacaagcactgcaagggatgcggtatctgtgccaaggtg
tgtcccgtcaacgccattgacatgttccccgaggacgaaatcaagaaggtaaaggaggcg
aacaaggatgaaaactaa

DBGET integrated database retrieval system