KEGG   Tannerella sp. oral taxon HOT-286: BCB71_09980Help
Entry
BCB71_09980       CDS       T04474                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
toh  Tannerella sp. oral taxon HOT-286
Pathway
toh00860  Porphyrin and chlorophyll metabolism
toh01100  Metabolic pathways
Module
toh_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:toh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCB71_09980
Enzymes [BR:toh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BCB71_09980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA Peptidase_S51 GATase DUF3037
Motif
Other DBs
NCBI-ProteinID: AOH41410
UniProt: A0A2R4KGU7
Position
complement(2457795..2459282)
Genome map
AA seq 495 aa AA seqDB search
MHSPLRPIMLAGTGSDVGKSVIAAALCRIFLQDGYHPAPFKAQNMALNSFVTADGLELGR
AQAVQAEAAGVPCHTDMNPLLLKPSGDSTSQVVLHGRPTGNQHASAYFRREGRAELEREV
HAAFDRLAARYNPIVMEGAGSISELNLRDVDLVNLPMARYADASVLLVADIDRGGVFASV
YGSIMLQTPEDRQRIRGVLINKFRGDMSLFGSGRRMIEELCGVPVVGVVPHFTDIYIEEE
DSVTLRTKQREAVEGRINVAVVLLRHMSNFTDFDVLERDERVHLFYTNNTEELCKADIIL
LPGSKNTLDDLSDLRRNGAAGAIQRAYRDGAVVMGICGGYQMMGREVCDPDHVEGDIERL
PGLGLLPVTTRLTKEKTTRQVSFRMVNDPRMCRGYEIHMGETRLEAGASDVLPLTEGDGV
DTGWRVGERCMGSYIHGILDNAPAIDCLLRPVIGRIDTRRTFDYAAFKEEQYDRLADHVR
RHVDMAQIYGMMKKR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcattcccccctccgtcccatcatgctcgcgggtacgggcagcgacgtcggcaagagc
gtgatcgccgccgcactctgtcgcatcttcctccaggatggctaccatcccgcacccttc
aaggcgcaaaacatggcgctgaactccttcgtcaccgccgacggtctcgagctgggccgc
gcgcaggcggtgcaagccgaagccgctggcgtgccctgccatacggacatgaatccgctc
ctgctcaagccttcgggcgacagcacctcgcaggtcgtcctgcacggtcgtccgacgggc
aaccaacacgcctcggcctactttcgacgcgaaggccgcgccgaattggagcgagaggtg
catgccgctttcgaccgactcgctgcccgttacaaccccatcgtcatggagggtgcaggc
agcatctctgagctgaatcttcgcgatgtagacctcgtcaacctccccatggcgcgttat
gctgacgcctccgtcttgctcgtggccgacatcgatcggggcggcgtttttgcctccgtc
tatggctccatcatgctccaaactccggaggatcgacagcgtatccgcggcgtactcatc
aacaagttccgcggcgatatgagcctcttcggcagtggtcgtcggatgatcgaggagctt
tgtggtgtgcctgtcgttggcgtcgtgccgcacttcaccgatatatatattgaggaggag
gacagcgtcacgctccgcaccaagcagcgcgaggccgtcgaggggcgcatcaacgtagcc
gttgtgctgctgcgccacatgagcaacttcacggacttcgacgtcctggagcgcgacgag
cgggtgcaccttttttacaccaacaacaccgaggagctgtgcaaggcggacatcatcctg
ctgcccggctcgaagaacacgctcgacgacctctctgatctgcgtcgcaacggtgcggcc
ggagccatccagcgtgcctaccgagacggcgccgtggtgatgggcatctgcggcggctac
caaatgatggggcgcgaagtctgtgacccggatcacgtggagggcgacatcgagcgtctg
cccggcctcgggctcctgcccgtcaccacccgcctaacaaaagaaaagaccacgcggcag
gtcagcttccgcatggtcaatgatccgcgtatgtgtcgcggctatgagattcatatgggg
gaaacgcgcctcgaggctggtgcatcggatgtgcttccgctgactgagggtgatggcgtc
gatacgggctggcgcgtgggcgagcgttgcatgggctcatatatccacggcatactcgac
aacgctccggccatcgattgcctgctgcgccccgttatcggccgcatcgatacgcgtcgc
acgttcgattacgccgccttcaaagaggagcaatacgaccgcctggccgatcatgtgcgc
cgtcacgtggacatggcgcagatctacgggatgatgaagaagaggtag

DBGET integrated database retrieval system