KEGG   Tannerella sp. oral taxon HOT-286: BCB71_10155Help
Entry
BCB71_10155       CDS       T04474                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
toh  Tannerella sp. oral taxon HOT-286
Pathway
toh00230  Purine metabolism
toh00250  Alanine, aspartate and glutamate metabolism
toh01100  Metabolic pathways
Module
toh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:toh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BCB71_10155
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCB71_10155
Enzymes [BR:toh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BCB71_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AOH41979
UniProt: A0A2R4KKW9
Position
complement(2516652..2517917)
Genome map
AA seq 421 aa AA seqDB search
MKVDVLLGLQWGDEGKGKVVDVLTPKYDAVARFQGGPNAGHTLEFGGERYILRSIPSGIF
QGGKTNIIGNGVVIDPLLFKEEAEALANHGHNLKQQLMISKKAHLIMPTHRILDLANEAA
KGSGKIGTTGKGIGPTYTDKISRNGLRVGDLLENFDEKYSAAKRRHENMLRAMNFEYNLI
DLERPWLEALDYLKGFRLVDSEHEVNAMLREGRSVLAEGAQGTMLDIDFGSYPFVTSSNT
ICAGCCTGLGVSPRNIGEVYGIFKAYCTRVGSGPFPTELHDETGEAMCERGHEFGSVTGR
RRRCGWIDLVALRYAVMIDGVTQLIMMKSDVLDTFNVIKACVAYRVDGVETDRFPFDLSK
AEPIYAELPGWRTDMSRMKSEDEFPEEFNAYLTFLEDELGVPIKIVSVGPDREQTIIRYN
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagacgttttattaggcctccaatggggcgacgaaggcaaaggcaaagtggtc
gacgtattgacgccgaagtacgatgcggtagcgcggttccaagggggacccaacgcagga
catacgcttgagtttggcggagagcgatacatactccgctccattccctctggcatattc
cagggtgggaagacaaacataattggcaacggggtggtaatcgatccgcttctctttaag
gaggaagccgaagcgttggccaatcacgggcacaacttgaagcagcaactgatgatctcg
aagaaagcccatttgatcatgccaacccatcggatactcgatttggctaacgaggccgct
aagggatcgggaaaaataggtacgacgggcaaaggcattggcccaacgtataccgataag
attagccggaacggactccgggtaggcgacctattggaaaacttcgacgagaagtattcc
gccgccaaacgccgacacgaaaacatgcttcgggcgatgaacttcgagtacaacttgatt
gacctcgagcgtccgtggctcgaagccctggactatttgaagggcttccgacttgtggac
agcgagcacgaggtgaacgcgatgctccgcgagggtcgctcggtgcttgccgagggtgcg
cagggtacgatgttggacatcgatttcggttcctatcccttcgtcacttcctcaaataca
atctgcgccggatgctgcacaggcctgggagtctcgccgcgaaatattggcgaagtgtac
ggcatcttcaaagcctattgcacacgcgtgggcagtgggcccttccctacggagttgcac
gatgaaacgggggaggctatgtgcgagcgcggacacgagttcggatcggttacggggcgc
cgtcgccgatgcgggtggattgacctcgtggctttgcgttacgctgtgatgatcgacggc
gtaacccaactgatcatgatgaagagtgacgtcctggatacctttaacgtcatcaaggct
tgtgtggcctatcgcgtggacggggtggagacggatcgcttcccctttgacctttcaaag
gccgaacccatatacgcggagctgcccggatggcgtaccgatatgtcaaggatgaagagc
gaagacgaatttcccgaggagttcaacgcctatttgactttcctcgaggatgagctgggc
gtacccattaagatcgtctcagtcggccccgatcgcgagcagactatcatccgctacaac
gagtag

DBGET integrated database retrieval system