KEGG   Tannerella sp. oral taxon HOT-286: BCB71_11085Help
Entry
BCB71_11085       CDS       T04474                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
toh  Tannerella sp. oral taxon HOT-286
Pathway
toh00471  D-Glutamine and D-glutamate metabolism
toh00550  Peptidoglycan biosynthesis
toh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BCB71_11085 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCB71_11085 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:toh01011]
    BCB71_11085 (murD)
Enzymes [BR:toh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BCB71_11085 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:toh01011]
 Precursor biosynthesis
  Amino acid ligase
   BCB71_11085 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOH41992
Position
2730208..2731665
Genome map
AA seq 485 aa AA seqDB search
MHDLCLNKQAPVCLRPACGEPDGSQDGLPTRHASRIVVLGAGESGVGAAVLAWTKGYDVF
VSDCGTIAEKYKAMLLDRGILFEEGHHTEAQILNADEIVKSPGIPDTAPIVRAAVERGIP
ILSEIELAGRYTDAQMVCITGSNGKTTTTSLTYQILREAGMDVGLAGNIGRSLALQVAED
PHACYVIELSSFQLDNMYSFKADIAVLMNITPDHLNRYGGEMQRYVDAKLRILQNQTRAD
AFIYWADDPILRREVAKHHPEAACYPFSDADRPELKGRLTADGQICIETPRGTLRIPRTA
LALRGTHNLYNSLAAATAARLAGADDASIRRGLETFRGVEHRLEPVARVAEVEYINDSKA
TNIDSCRYALQSVETPIVLILGGTDKGNDYGEIEAMVRAKARGLVFLGVDNRKLHAAFDG
KVPATCDARSMAEAIAQAARMARPGDTVLLSPCCASFDLFRNYEDRGEQFKQCVHALADG
KEAGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatctgtgccttaataaacaggcgcctgtttgcctccgcccggcgtgcggcgaa
ccagacgggtcgcaagatggcctcccgacacgccacgcaagccgaatcgtcgtcctgggt
gcaggcgagagtggcgtgggagccgcggtgttggcgtggacgaagggctacgacgtgttc
gtgtccgattgtggcacgatcgcggagaaatacaaggcgatgctgctcgatcgcggtatc
ctctttgaagagggccatcacacggaggcccagatcctcaacgccgacgagatcgtcaag
agccccggcatacccgacacggcgcccatcgtgcgcgcggccgtggagcgtggtatcccg
atcctctccgagatcgagctggccggacgatacaccgacgcgcagatggtctgcatcacg
ggcagcaatggcaagacgacgaccacgtcgctgacgtaccaaatcctgcgcgaggccggc
atggacgttggtctggcgggcaacatcgggcgcagcttggccctgcaagtggccgaggat
ccgcacgcgtgctacgtgatcgaactgagcagtttccagctcgacaacatgtacagcttc
aaggccgacatcgctgtgctgatgaacatcacgcccgaccacctgaaccgttacggcggc
gagatgcagcgttatgtggacgccaagctgcgcatcctgcaaaaccaaacccgggcggac
gccttcatctattgggccgacgaccccatcctgcggcgcgaggtggccaagcatcacccc
gaggccgcctgctaccccttctccgacgccgaccggccggagctgaagggccgcctcacg
gccgacgggcagatctgtatcgagacgccccgcggcacgctccgtatcccccgcacagcc
ctcgcgctgcgtggcacacacaacctctataactccctcgccgcggccacggcggcccgt
ctggctggggctgacgatgcctcgatccgccgcggtctggagacgtttcgcggcgttgag
caccgcttggagccggtggcacgcgtggccgaggtggaatacatcaacgattcgaaggcc
acgaacatcgactcctgccgctatgccctgcaaagcgtcgagacgccgatcgtgctcatc
ctcggcggcacagacaagggcaacgattacggggagatcgaggccatggtacgggcgaag
gcccgcgggctcgtcttcctcggtgtggacaatcggaagctccacgcggccttcgacggt
aaggtgcccgccacctgcgacgcccgctcgatggcagaggccatcgcccaggccgcccgc
atggctcgtccgggcgatacggtgctgctctcgccctgttgcgccagcttcgacctcttc
cgcaactacgaagaccgcggcgagcagttcaaacaatgtgtccatgcgctggcggacgga
aaggaggccggggcatga

DBGET integrated database retrieval system