KEGG   Thalassolituus oleivorans MIL-1: TOL_0716Help
Entry
TOL_0716          CDS       T02529                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
tol00071  Fatty acid degradation
tol00280  Valine, leucine and isoleucine degradation
tol00310  Lysine degradation
tol00362  Benzoate degradation
tol00380  Tryptophan metabolism
tol00620  Pyruvate metabolism
tol00630  Glyoxylate and dicarboxylate metabolism
tol00640  Propanoate metabolism
tol00650  Butanoate metabolism
tol00900  Terpenoid backbone biosynthesis
tol01100  Metabolic pathways
tol01110  Biosynthesis of secondary metabolites
tol01120  Microbial metabolism in diverse environments
tol01130  Biosynthesis of antibiotics
tol01200  Carbon metabolism
tol01212  Fatty acid metabolism
tol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TOL_0716
   00630 Glyoxylate and dicarboxylate metabolism
    TOL_0716
   00640 Propanoate metabolism
    TOL_0716
   00650 Butanoate metabolism
    TOL_0716
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TOL_0716
   00072 Synthesis and degradation of ketone bodies
    TOL_0716
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TOL_0716
   00310 Lysine degradation
    TOL_0716
   00380 Tryptophan metabolism
    TOL_0716
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TOL_0716
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TOL_0716
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TOL_0716
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tol04147]
    TOL_0716
Enzymes [BR:tol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TOL_0716
Exosome [BR:tol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TOL_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5423
Motif
Other DBs
NCBI-ProteinID: CCU71154
UniProt: M5E082
Position
757232..758437
Genome map
AA seq 401 aa AA seqDB search
MTEAYIFDAVRTPRGRGKKDGSLHSVTPVNLMSGLLRELQKRNDLDTSKLDDVVLGCVEP
VMEQGADIARTAVLMADYAQTVAGTVVSRFCASGLEAVNMAAAKVKAGEAQMTIGGGVEC
MSRIPMGSGGGAYYTDPSVTNKLSFVPQGISADLIATMHGFSRADVDAYAVESQRRAKHA
WDNGFFAKSVVPVKDQLGFTLLDRDEHMRPGATVEGLGKLNASFEMHGGLGFDAIAQQVY
PQVERINHVHHAGNSSGIVDGASAVLIGTREMGAALGLTPRARIVAAASVGSEPTIMLTG
PAPSARKALANARMQASDIDLWELNEAFASVVMLFMKEMGIDHSRINVNGGAIAMGHPLG
ATGAMILGTVLDELERTNKRTALINLCVGGGMGTATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctatatttttgatgccgttcgtacccctcgtggtcgcggtaaaaaagac
ggtagtttgcacagcgtaacccctgtgaatttaatgtcgggtttattgcgtgaattacaa
aagcgtaatgatctcgatacatcgaaattagatgatgttgttttggggtgcgtcgagccg
gtaatggaacaaggtgctgatattgctcgcaccgccgtactgatggccgactacgcgcaa
actgttgcgggtaccgtggtgagccgtttttgtgcttcgggcttagaggccgtgaacatg
gctgcagctaaagtcaaagcgggcgaagcacagatgacgattggtggcggcgttgaatgt
atgtcgcgtattcctatgggatcaggcggtggtgcgtattacaccgatccatcggtaacc
aataaattatcatttgtaccacaaggtatttccgctgatttaattgccactatgcacggt
ttttcgcgcgccgatgtggatgcctatgcagtagagtcacagcgtcgtgctaagcacgct
tgggataacggatttttcgctaaatcagttgtaccagtaaaagatcagcttggttttacc
ttattggatcgtgatgaacatatgcgtccaggagctacggtcgagggtttaggtaaacta
aatgcatcgtttgaaatgcatgggggactaggtttcgacgcgattgcgcaacaggtttat
ccacaggttgagcgcattaatcacgttcatcatgccggtaactcatcgggtattgttgac
ggtgcttcggcggtattaatcggtactcgcgaaatgggtgctgcgttaggtttaactcca
cgtgcgcgcattgttgcagcggcttcggttggttctgaaccaaccattatgttaaccggc
ccagcgccaagtgctcgtaaggcattagccaatgcacgtatgcaggcttcggatatcgac
ttgtgggaattaaacgaagcgtttgcctcggtggtgatgctgtttatgaaagaaatgggc
atcgaccatagtcgtatcaatgtgaatggcggcgcgattgcgatgggccatccgctcggt
gcaacaggtgccatgattttaggtacagtgctggatgaactcgaacgcacgaataaacgc
actgcactgattaatttatgtgttggtggtggtatgggtacagcaacgattatcgaacgc
gtttaa

DBGET integrated database retrieval system