KEGG   Thalassolituus oleivorans MIL-1: TOL_3635Help
Entry
TOL_3635          CDS       T02529                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
tol00010  Glycolysis / Gluconeogenesis
tol00020  Citrate cycle (TCA cycle)
tol00620  Pyruvate metabolism
tol01100  Metabolic pathways
tol01110  Biosynthesis of secondary metabolites
tol01120  Microbial metabolism in diverse environments
tol01130  Biosynthesis of antibiotics
tol01200  Carbon metabolism
Module
tol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL_3635
   00020 Citrate cycle (TCA cycle)
    TOL_3635
   00620 Pyruvate metabolism
    TOL_3635
Enzymes [BR:tol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     TOL_3635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: CCU74018
UniProt: M5DX52
Position
3812393..3813928
Genome map
AA seq 511 aa AA seqDB search
MTTVYTDLSTPFLVEQAILRGEGQLQDNGALVVETGARTGRSPMDRYIVEEPSSKDAIDW
GNINRPFDADKFDALWERVEEYLSQHDSFVSHVHVGSDSQHYLPVKMTTQTAWQNLFGRN
LFIRPESYNSSSKEEWQILNVAGFECVPERDGTNSDGCVILNFAQRKVLLAGMRYAGEMK
KAMFSVQNFLLPEKDVLPMHCSANVGDDGDTCLFFGLSGTGKTTLSADPERYLIGDDEHG
WGKGTVFNIEGGCYAKTIDLSQKNEPIIWNAIKFGAIVENVVINEARTADYTDVSLTENG
RCAYPLEHVEKRVAENKGGEPKAVIFLTCDMTGVLPPVSVLTKEQAAYHFLSGYTALVGS
TEMGGSKGLKSTFSTCFGAPFFPRPAGEYAELLMKRVTEFDSQVYLVNTGWTGGANGAGG
ERFSIPTTRAVISAIQTGALRDAETETLPVFGLNVPKAVSGVDTHLLNPINAWGDEAKWT
EAAKGLAAQFTANFKKYDVSDAIVAAGPSAE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtttacaccgacttatccacaccatttttggtagaacaagcgattctgcgt
ggcgaaggccaattgcaggacaatggcgcactggttgtagaaactggtgctcgtactggc
cgctcgccaatggaccgctacatagttgaagagccgagcagcaaagacgccatcgactgg
ggcaacatcaaccgcccattcgacgccgacaagttcgacgccctttgggagcgagtggaa
gagtatctgtcgcagcacgacagcttcgtttctcatgtccatgtaggttctgattcacaa
cattacctgccagttaaaatgaccactcagactgcttggcagaacctgtttggccgcaac
ttgttcatccgcccagaaagctacaatagctcttctaaagaagagtggcagattttgaac
gtggctggttttgaatgtgtacctgagcgtgacggcaccaactctgacggttgtgtgatc
ctcaacttcgctcaacgcaaagtattattagctggcatgcgttacgccggtgaaatgaaa
aaagccatgttctctgtacaaaacttcctgttgccagaaaaagacgtgctaccaatgcac
tgctctgccaacgtaggtgacgacggcgacacttgcttgttcttcggtttgtcaggtact
ggtaaaaccaccctatctgctgacccagagcgttacctaattggtgacgacgagcacggc
tggggcaaaggcacagtattcaacatcgaaggtggctgctacgcaaaaaccatcgacttg
tctcagaaaaacgaacccatcatttggaacgcgatcaagtttggcgccatcgttgaaaac
gtcgtaatcaacgaagctcgtactgccgattacaccgatgtcagcctgactgaaaacggt
cgttgtgcgtacccacttgagcacgtagaaaagcgcgttgcagaaaacaaaggtggcgag
ccaaaagcggttatcttcttaacttgcgatatgacaggtgttcttcctccagtgtcagta
ctgaccaaagaacaagcggcttatcacttcctaagtggttacacagcccttgttggttct
actgaaatgggtggatctaaaggccttaagtcgaccttctctacttgtttcggcgcacca
ttcttcccacgtccagcgggtgaatacgctgaattgttgatgaagcgtgttactgaattc
gactcacaagtgtacctagtaaacaccggctggactggtggtgctaacggcgcaggcggc
gagcgtttctctatcccaaccactcgtgccgtgatcagtgctattcaaactggcgcgtta
cgcgatgcggaaactgagactcttccagtgttcggcttgaacgtacctaaagccgttagt
ggtgtagacactcacctgttgaacccaatcaatgcttggggcgacgaagcaaaatggact
gaagcggcaaaaggtttggcagctcagttcactgcaaactttaagaaatacgatgtatct
gatgccatcgtagctgcaggtccttcagcagaataa

DBGET integrated database retrieval system