KEGG   Tateyamaria omphalii: BWR18_03225Help
Entry
BWR18_03225       CDS       T04652                                 

Definition
(GenBank) multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
tom  Tateyamaria omphalii
Pathway
tom00230  Purine metabolism
tom00240  Pyrimidine metabolism
tom00760  Nicotinate and nicotinamide metabolism
tom01100  Metabolic pathways
tom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BWR18_03225
   00240 Pyrimidine metabolism
    BWR18_03225
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BWR18_03225
Enzymes [BR:tom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BWR18_03225
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     BWR18_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap Metallophos_2
Motif
Other DBs
NCBI-ProteinID: APX10813
UniProt: A0A1P8MS45
Position
664793..666352
Genome map
AA seq 519 aa AA seqDB search
MTRFLMGTAALALSAGMASADYTLHILHTNDMHSRIESINRFDSTCNAEGEAEGECFGGV
ARVKSAIDAKKASLDNQNVVVLDAGDPFQGSLFYTTYKGAAEAEFMEKIGYDAMAVGNHE
FDDGPPKLAEFIDAVSFPVISGNLDLSAEDTLSGKVENHVVLEVGGKKIGIVSALATDTV
ETSSPGPNVVFQDEIEALQADVATLQGEGVDIIIALNHVGLNKDLAIAEAVDGIDVVIGG
HSHTLMSNDDAETPAYPTMVGDAAVAQAYAYTKYLGHLTVTFDDDGNVTAASGDPMLLDA
SVEPDADFLARIAEMGAPIEEMKTRVVAEAAEAIEGDRSVCRAMECPMGSLIADAMLDRV
ADQGIEIAIQNGGGIRASIDAGEITMGEVLTVLPFQNTLSTFQVPGSAIVAALENGVGQI
EDGAGRFPQVAGMSFAFDVSKPAGERVSDVMVGGAPIEMDKVYGVVSNNYVRNGGDGYAM
FVDAENAYDFGPDLADVTAEYLAAQGPFTPYTDGRITAK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacccgatttttgatgggcacggccgccctggcgctgagcgctggcatggcatccgcc
gactacacgctgcacattctgcacaccaacgacatgcacagccgcattgaatcgatcaac
cgcttcgattcgacctgcaatgccgagggcgaggccgaaggcgaatgctttggcggtgtg
gcgcgggtcaaatcggccatcgacgccaagaaggccagcctggacaaccagaacgttgtt
gttctggacgcaggcgacccgttccagggctcgctcttctacaccacgtacaagggtgcg
gcagaggccgagttcatggaaaagatcggctatgacgccatggccgtcggcaaccacgaa
ttcgacgatggcccgccaaaactggccgagttcatcgacgcggtgagctttcccgtgatc
tctggcaaccttgacctgtcggccgaggacacgctgagcggcaaggtcgaaaaccacgtc
gtgctcgaggtgggcggcaagaagatcggcatcgtctcggcgctcgccaccgacacggtc
gaaacctcctcgcccggtcccaacgtcgtattccaggacgagatcgaggcgctgcaggct
gacgtcgccacgctgcaaggcgaaggagtggacatcatcatcgcgctgaaccacgtgggc
ctgaacaaggatctagccattgccgaggccgtagacggcatcgacgtggtgatcggcggg
cacagccacacgctgatgtccaatgacgacgccgaaacaccggcataccccaccatggtg
ggcgatgcggcggtcgcgcaggcctatgcctataccaagtatctcggccacctgactgtc
acttttgacgatgacggcaacgtaacggcggcctcgggcgatccgatgctgctcgatgcc
tcggtcgagcccgatgccgacttcctcgcccgcatcgccgaaatgggcgcaccgatcgaa
gagatgaaaacacgcgtcgtcgccgaagccgccgaagccatcgaaggcgaccgctcggtg
tgccgcgcgatggaatgccccatggggtcgctcatcgccgacgcgatgctcgaccgggtg
gccgatcaggggatcgagatcgcgatccagaacggcggtggcatccgcgcctcaattgac
gcgggcgaaatcacgatgggcgaagtgctgacggtgctgcccttccagaacacgctgtcc
accttccaggtgcccggctcggccattgtcgccgcgcttgaaaacggcgtgggccagatc
gaagacggcgcgggccgcttcccgcaggttgcgggcatgagctttgcctttgacgtgtca
aagcccgcaggcgagcgcgtcagcgacgtcatggtcggcggcgcgcccatcgagatggac
aaggtctatggcgtggtcagcaacaactacgtgcgcaatggtggcgacggctacgcgatg
ttcgtggatgccgaaaacgcctatgacttcggaccggacctggcggacgtgacggcagag
tacctggccgcgcaggggccgttcacgccctataccgacggtcggatcacggcgaagtaa

DBGET integrated database retrieval system