KEGG   Tateyamaria omphalii: BWR18_11730Help
Entry
BWR18_11730       CDS       T04652                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tom  Tateyamaria omphalii
Pathway
tom00071  Fatty acid degradation
tom00072  Synthesis and degradation of ketone bodies
tom00280  Valine, leucine and isoleucine degradation
tom00310  Lysine degradation
tom00362  Benzoate degradation
tom00380  Tryptophan metabolism
tom00620  Pyruvate metabolism
tom00630  Glyoxylate and dicarboxylate metabolism
tom00640  Propanoate metabolism
tom00650  Butanoate metabolism
tom00900  Terpenoid backbone biosynthesis
tom01100  Metabolic pathways
tom01110  Biosynthesis of secondary metabolites
tom01120  Microbial metabolism in diverse environments
tom01130  Biosynthesis of antibiotics
tom01200  Carbon metabolism
tom01212  Fatty acid metabolism
tom02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWR18_11730
   00630 Glyoxylate and dicarboxylate metabolism
    BWR18_11730
   00640 Propanoate metabolism
    BWR18_11730
   00650 Butanoate metabolism
    BWR18_11730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWR18_11730
   00072 Synthesis and degradation of ketone bodies
    BWR18_11730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWR18_11730
   00310 Lysine degradation
    BWR18_11730
   00380 Tryptophan metabolism
    BWR18_11730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWR18_11730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWR18_11730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BWR18_11730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tom04147]
    BWR18_11730
Enzymes [BR:tom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BWR18_11730
Exosome [BR:tom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWR18_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APX12274
UniProt: A0A1P8MW39
Position
2375655..2376830
Genome map
AA seq 391 aa AA seqDB search
MTNIVIASAARTAVGSFGGSFANTPAHDLGATVLEAVVERAGIDKSDVSETILGQVLTAA
QGQNPARQAHINAGLPKESAAWSINQVCGSGLRAVALGAQHIALGDADIVAAGGQENMTL
SPHAAALRAGHKMGDMKYIDTMIRDGLWDAFNGYHMGQTAENVADQWQITRDTQDEFAVA
SQNKAEAAQKAGKFADEITAFTVKGRKGDTIVDADEYIRHGATMEAMAKLRPAFTKDGSV
TAANASGLNDGAAAALLMSAENAEKRGIEPLARIASYATVGLDPSIMGVGPIYASRKALE
KAGWKPEDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGARILNTL
LFEMKRRDAKKGLATLCIGGGMGVAMCLERD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacatcgtcatcgcttcagccgcccgcactgccgttggcagctttggtggctct
ttcgccaacacccccgcccatgaccttggcgcaaccgtgctcgaagcggtggtggagcgc
gcagggatcgacaaatccgacgtctctgaaaccatcctcggccaggtgctgacagccgcc
cagggccagaacccggcccgccaggcgcatatcaacgccgggctccccaaggaaagcgcg
gcctggtccatcaaccaggtctgcggctccggcctgcgcgccgtggcgctgggtgcccag
cacatcgcgctgggtgacgccgatatcgtggccgccggtggccaggaaaacatgaccctc
tcgccccacgccgccgccctgcgcgccggtcacaagatgggcgacatgaaatacatcgac
acgatgatccgcgacggtctgtgggacgccttcaacggctaccacatgggccagacggca
gagaatgttgccgatcagtggcaaatcacccgcgacacgcaggacgaatttgccgttgca
tcgcaaaacaaggccgaagccgcgcaaaaggccggcaagttcgcagacgaaatcaccgcc
ttcaccgtcaagggccgcaagggcgacaccatcgtcgacgccgatgaatacatccgccac
ggcgccacaatggaagcgatggccaagctgcgccccgccttcaccaaggacgggtcggtc
accgccgccaacgcctccggcctgaacgacggcgccgccgcggccctgctgatgagcgcc
gaaaacgcagaaaaacgcgggatcgaaccgctggcgcgcatcgccagctacgccaccgtc
ggcctcgacccgtccatcatgggcgtgggcccgatctatgccagccgcaaggcactggaa
aaagccgggtggaaacccgaagacctcgaccttgtcgaagccaacgaagccttcgccgcg
caagcctgcgccgtgaacaaggacatgggttgggacccggcgatcgtgaacgtgaacggc
ggcgccatcgcaatcggccaccccatcggcgcctcgggcgcccgcatcctcaacaccctg
ctgttcgagatgaagcgccgcgacgcgaaaaagggcctcgccacgctctgcatcggtggc
ggcatgggtgtcgccatgtgcctcgagcgcgactga

DBGET integrated database retrieval system