KEGG   Tateyamaria omphalii: BWR18_15730Help
Entry
BWR18_15730       CDS       T04652                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
tom  Tateyamaria omphalii
Pathway
tom00740  Riboflavin metabolism
tom00790  Folate biosynthesis
tom01100  Metabolic pathways
tom01110  Biosynthesis of secondary metabolites
tom02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BWR18_15730
   00790 Folate biosynthesis
    BWR18_15730
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BWR18_15730
Enzymes [BR:tom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BWR18_15730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APX13935
UniProt: A0A1P8N0T1
Position
3148830..3149918
Genome map
AA seq 362 aa AA seqDB search
MGLGPDIVEMLARARADLRMGVPIVVLAEVSVLAVAVEAMTPERLAALRALGAPLELALT
GWRAETMKARVYDGDVARIAVPEAAALGWLQSLADPADDLATPMKGPLQSLRDGDAAAHR
VAIQLCKAARLLPAALCAPVPEGLKFAVSHSLTAIPLALAEPLMAQSSLLHPVVQARLPV
EASEAGRLHVFRPEDGGEEHYAFEIGRPDRSQPVLARLHSACFTGDVMGSLKCDCGPQLR
GALAQMGAEGAGVLLYMNQEGRGIGLANKMRAYALQDQGFDTVDANHRLGFEDDERDFRL
GSDILKSMGFASVRLLTNNPAKVAMMEASGISVTERVPLKVGENRFNRDYLATKAAKSGH
LL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggggttgggcccggatatcgtggagatgctggcgcgggcccgtgccgatctgcgcatg
ggcgtgcccattgtggtcctggccgaggtgtcggtgctggccgttgcggtcgaggcgatg
acgcccgaacggctggccgcgctgcgcgcgcttggggcgccgttggaactggccctgact
ggatggcgggctgaaacaatgaaggcgcgggtgtatgatggcgatgtggcccggattgcc
gtgccggaggccgccgccctgggttggctgcaatcgcttgccgatcccgcagacgatctg
gccacccccatgaaggggccgttgcagtcgctgcgcgatggcgatgcagcagcgcaccgg
gtcgctatccaactgtgcaaggcggcgcggttgctgcctgccgccctatgcgcgcccgtt
cctgagggtttgaaattcgccgtgtcccatagcttgaccgcaatccccctcgccttggca
gagccgctgatggcgcagtcgagcctgctgcatcccgtcgtgcaggcccgtctgccggtg
gaagcctccgaagcggggcggctgcacgtctttcgccccgaggatggaggggaggagcat
tacgcgttcgagatcgggcgcccggatcgcagccaaccggtgctggcccgcctgcattcg
gcctgtttcacaggggatgtcatgggcagcctgaaatgcgattgcgggccgcagctgcgg
ggtgccctggcccagatgggggccgagggggcgggtgttcttctctatatgaatcaggag
gggcgcgggattggcctggccaacaagatgcgtgcctatgccttgcaggatcaggggttc
gacaccgtcgatgccaatcaccggcttgggttcgaggatgatgagcgggattttcggctg
gggtcggacattctgaagtccatgggatttgcgtccgtccgcctgttgaccaataacccc
gccaaggttgcgatgatggaggcgagtgggatcagcgtgaccgagcgggtgcctttgaaa
gtgggtgagaaccggttcaaccgggattatctggccaccaaggcggcgaagtcggggcat
ctgctgtga

DBGET integrated database retrieval system