KEGG   Tateyamaria omphalii: BWR18_17840Help
Entry
BWR18_17840       CDS       T04652                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tom  Tateyamaria omphalii
Pathway
tom00970  Aminoacyl-tRNA biosynthesis
tom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tom00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BWR18_17840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tom03029]
    BWR18_17840
Enzymes [BR:tom01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BWR18_17840
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BWR18_17840
Mitochondrial biogenesis [BR:tom03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BWR18_17840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF1194
Motif
Other DBs
NCBI-ProteinID: APX13331
UniProt: A0A1P8MZ53
Position
3564632..3565960
Genome map
AA seq 442 aa AA seqDB search
MQEWLGKSAADLGRAIGAGEVDPIALSRAFFERIEGHELRDRVYARLTRDRAMAEARAAA
ARAASGRRLSVLDGVPVSWKDLFDTAGDGTEAGSNLLAGRVPDRDAVVVQNATAAGLVCL
GKTHMSELAFSGLGYNPSTATPPCVNDAEAVPGGSSSGAAASVAFGLAPAAIGSDTGGSV
RIPAAWNDLVGLKTTHGRLSLEGCVPLSLKFDTVGPLTRTVEDAALLMAVMEGRAPCDLR
GASLKGRRFALLKTVVLDDIRDAPRAAYESAVERLCAAGAVVEPLEVPELEEALAQAGPL
MPGEVYGLWRDVIEAQPEAMYSEILQRFRLGKAFSAPDYNAAWAKLEAVRQAWDMAVAPY
DAVLAPTAPNVPPNLERLTSYGDYYKTENLLALRNTRVGNLMGICALTLPTGVPSCGIMM
MGFRGGEEALLRLGVAAEEALS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagtggttgggcaagagtgcggcggatctgggccgcgccattggtgcgggtgag
gttgatccgattgcgttgtcccgcgcgtttttcgagcgcattgaggggcatgagctgcgg
gatcgggtatatgcccgattgacgcgggatcgggcgatggccgaggcccgcgcggctgcc
gcgcgtgcggcgtcggggcggcggttgtcggtgctggatggtgtgcctgtcagctggaag
gacctgttcgataccgccggggacgggaccgaggcgggatcgaacctgctggccggtcgt
gtgccggaccgcgatgctgttgtggtgcagaatgcgacggcggcgggtctggtgtgtctg
ggcaagacccatatgagcgagttggcgttttcagggttggggtacaacccgtcgaccgcg
acgccgccttgcgtgaatgatgcggaggctgtgccgggggggtcgtcctcgggtgcggcg
gcgtcggtggcctttgggctggcgcctgcggccatcgggtcggatacgggcgggtcggtg
cgtattccagccgcgtggaacgatctggtggggttgaagaccacccacgggcggttgtcg
ctggagggctgtgtccccttgtcgctgaagttcgatacggtggggccgttgacgcggacg
gtggaggatgccgccctgttgatggcggtgatggaggggcgtgcgccctgtgatctgcgt
ggcgcgtcgttgaaggggcgccgctttgcgctgttgaagacggtggtgctggacgacatt
cgggacgcgccgcgggcggcttatgagagtgcggtggagcggctctgtgccgcgggtgcc
gtggtggagccgctggaagtgccggagttggaggaggcgctggcgcaggcggggccgttg
atgccgggtgaggtgtacgggctgtggcgtgatgtgatcgaggcgcagcccgaggcgatg
tattcggagattttgcagcggtttcggctgggcaaggcattcagcgcgcccgattacaat
gccgcatgggccaagctggaggccgtgcggcaggcctgggatatggctgtggcgccctat
gatgcggtgctggcgccgacggcgccgaatgtgccgccaaatctggagcgtttgaccagc
tatggcgactattacaagaccgagaacctgctggcgctgcgcaacacccgggtgggcaat
ttgatggggatttgtgcgctgaccttgcccacgggcgtgcccagttgcgggatcatgatg
atgggttttcgaggtggcgaagaggcgttgttgcggttgggggtcgcggcggaagaggcg
ttgagctga

DBGET integrated database retrieval system