KEGG   Thermococcus onnurineus: TON_1032Help
Entry
TON_1032          CDS       T00789                                 

Definition
(GenBank) deblocking aminopeptidase
  KO
K20608  tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
ton  Thermococcus onnurineus
Brite
Enzymes [BR:ton01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     TON_1032
Peptidases [BR:ton01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   TON_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACJ16520
UniProt: B6YWQ7
Position
953602..954648
Genome map
AA seq 348 aa AA seqDB search
MVDYALLKKIVEAPGVSGYEFLGVRDVVIEAFKPYVDEIKVDKLGNVIAHKKGSGPKVML
AAHMDQIGLMVTHIEKNGFLRVAPVGGVDPRTLIAQRFKVWIGPNEFIYGVGGSVPPHIQ
KPEERSKAPTWEQVFIDIGAESKEEAEEMGVKIGTIITWDGRLERLGKHRLVSIAFDDRI
AVYTLVKAAQELGETDADIYFVATVQEEVGLRGAKVSAFGIDPDYGFAIDVTIAADVPGT
PEHKQVTQLGKGTAIKIMDRSVICHPTIVRWMEELAKKYEIPYQWDILLGGGTDAGAIHL
NKAGVPTGAISVPARYIHSNAEVVDGRDVDAGVKLMVKVLEEIPGLKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggttgactacgcgctgctcaaaaagattgttgaggctcctggtgtttctggatatgag
tttttgggcgttagggacgttgtcatcgaggccttcaagccctacgtcgatgagataaag
gtcgacaagctcggcaatgtcatagcccacaagaaaggctccgggccaaaggtcatgctc
gcggcccacatggatcagataggccttatggtcacccatatcgagaagaacggattcctc
cgcgttgccccggttggcggtgttgacccaaggacgctcatagcccagaggtttaaagtc
tggattggcccgaacgagttcatctacggtgtcggtggaagtgttccaccgcacatccag
aagcccgaggagaggagcaaggctccgacctgggaacaggtcttcatcgacataggcgcc
gagagcaaggaggaagccgaggagatgggagttaagatcggcaccataatcacctgggac
ggaaggcttgagagactcggcaagcacagactcgtcagcatagcctttgacgacaggatt
gctgtctacacccttgtcaaggccgcccaggagctcggcgagaccgatgcggacatatac
tttgtggccaccgtccaggaggaggtcggcctccgcggtgcaaaggtttcagcctttggc
attgaccctgactacggcttcgccattgacgttaccattgccgctgacgttcctggaaca
ccggagcacaagcaggtcacccagctcggaaagggaaccgcaataaagataatggaccgc
tccgtcatctgccacccgaccatcgtcaggtggatggaggagctcgccaagaagtacgag
ataccctaccagtgggacatcctcctcggtggaggaaccgatgctggcgcaatacacctc
aacaaggctggcgttccaacgggagcgataagcgttccagcgagatacatccactccaac
gcggaagttgtggacggacgcgacgttgacgctggagttaagctgatggtcaaggttctc
gaagagattccggggcttaagctctga

DBGET integrated database retrieval system