KEGG   Thermococcus onnurineus: TON_1428Help
Entry
TON_1428          CDS       T00789                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ton  Thermococcus onnurineus
Pathway
ton00260  Glycine, serine and threonine metabolism
ton00750  Vitamin B6 metabolism
ton01100  Metabolic pathways
ton01110  Biosynthesis of secondary metabolites
ton01120  Microbial metabolism in diverse environments
ton01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_1428
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TON_1428
Enzymes [BR:ton01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TON_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACJ16918
UniProt: B6YXV5
Position
1306914..1308047
Genome map
AA seq 377 aa AA seqDB search
MKCPMCGKEYTEPIQRCECGEPVEFELFHGEPYIAKSVWERFYDFWPVEPNLELSLGEGD
TPLIRSRLGKELGVKLYLKNETANPTWSFKDRGTFLAMSYAVKVGYKAVGTVSTGNMAAS
VAAYAARAGLKAKILVSGSASDEKLKAVSIYGADVIRVMGDYGRLYFESLELGEELGIYF
MNSDNPFRVEGYKSIAFEIAEELTPDYVLIPTSSGGLFRGIAKGFLELFASGLIDKIPTL
IAVQAEGCSPICRAFSEGKGRIERFETPRTIAHAIENPYPPSGNVVLKLLRELGGKCVTV
SDEEILEAQKRLAEEGFFVQPSSATGIAALKKLNIPEEAKVVSILTGSGLKTISQIEGRS
VRECELEKLEGCLKSDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcccaatgtgtgggaaggagtacaccgaacccattcagaggtgtgagtgcggc
gagcccgttgagttcgagctcttccatggcgagccgtacatagcaaagagtgtctgggag
cgcttttacgacttctggccggtcgagccaaacctcgagctgagcctcggtgagggggac
actccactgattaggtcaaggctcggcaaagagctcggcgtaaagctctacctcaagaac
gagacagccaatccaacgtggagcttcaaggacagggggacatttttggcgatgagctac
gcggttaaggtcggctacaaagccgttgggactgtatcgaccggcaacatggcggcgagc
gttgcagcctacgccgcaagagcgggcctgaaagccaagatactcgtctcagggagcgcg
agcgatgagaagctcaaggccgtatccatctacggagccgacgtgataagagtaatgggc
gactacggaaggctctacttcgagagtctggaactcggagaagagctcggcatctatttc
atgaactcggacaaccccttcagagtggaggggtataagagcatcgccttcgaaatcgcc
gaggagctaacgcccgactacgttctgattccgacctcatctggcggacttttcagagga
atagcaaagggctttctcgagctcttcgcgagcgggctgattgacaagatcccaacgctc
atagcggttcaagcagagggctgctcgcctatatgcagggctttctctgaagggaaaggg
aggatagagcgctttgagactccacggacgatagcccatgccatagagaatccttatccc
ccaagcgggaacgtcgtccttaagctcctccgtgagctgggcggaaagtgcgtgactgtt
agcgacgaagagattttagaggcacaaaagagactcgccgaagaaggcttcttcgtccag
ccctcaagcgcgacaggaatagccgccctcaaaaagctcaacatccccgaggaagcgaaa
gttgtctcaatcctcaccggttccggcctgaaaaccatttcccagatagaagggagaagc
gttagggagtgcgagcttgaaaagcttgagggatgtctcaaaagcgattcataa

DBGET integrated database retrieval system