KEGG   Thermococcus onnurineus: TON_1480Help
Entry
TON_1480          CDS       T00789                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ton  Thermococcus onnurineus
Pathway
ton00010  Glycolysis / Gluconeogenesis
ton00020  Citrate cycle (TCA cycle)
ton00620  Pyruvate metabolism
ton00633  Nitrotoluene degradation
ton00640  Propanoate metabolism
ton00650  Butanoate metabolism
ton00680  Methane metabolism
ton00720  Carbon fixation pathways in prokaryotes
ton01100  Metabolic pathways
ton01120  Microbial metabolism in diverse environments
ton01130  Biosynthesis of antibiotics
ton01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1480
   00020 Citrate cycle (TCA cycle)
    TON_1480
   00620 Pyruvate metabolism
    TON_1480
   00640 Propanoate metabolism
    TON_1480
   00650 Butanoate metabolism
    TON_1480
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TON_1480
   00680 Methane metabolism
    TON_1480
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TON_1480
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TON_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_22 Fer4_8 Fer4_15 Fer4_17 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACJ16970
UniProt: B6YY07
Position
1354815..1355132
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIVYLPGSSVVNKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDDENYPVFDYDYCKGCGICANECPTEAIVMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtccgtttaaggccgacattgagagggttcagaaggagtatagcgaaaag
atgaccccgggagcgattgtctacctcccgggaagcagcgtcgtgaacaagaccggaagc
tggagagttttcatgccggagttcaacagggacaagtgcgttaggtgctatctctgctac
atctactgtccggagccagccatatatctcgacgatgagaactatccggtcttcgactac
gactactgtaagggctgtggaatttgtgcgaacgagtgcccgacagaggcaatagttatg
gttagggagaccaagtga

DBGET integrated database retrieval system