KEGG   Tetragenococcus osmophilus: C7K38_06380Help
Entry
C7K38_06380       CDS       T05711                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
too  Tetragenococcus osmophilus
Pathway
too00450  Selenocompound metabolism
too00970  Aminoacyl-tRNA biosynthesis
too01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:too00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C7K38_06380
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C7K38_06380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:too01007]
    C7K38_06380
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:too03016]
    C7K38_06380
Enzymes [BR:too01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C7K38_06380
Amino acid related enzymes [BR:too01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C7K38_06380
Transfer RNA biogenesis [BR:too03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C7K38_06380
 Prokaryotic type
   Other AARSs
    C7K38_06380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AYW48023
UniProt: A0A3G5FCI8
Position
1314156..1316168
Genome map
AA seq 670 aa AA seqDB search
MGEKGTFYITTPIYYPSGQLHIGNSYTTIACDAMARYKRLMGFDVFYLTGVDEHGEKIEK
KAEELGVAPQDYVDKMAVDIKKLWKTLGISYDKFIRTTDDYHQEAVQKIFQQLLDQGDIY
LGEYEGWYSVSDEEFFTETQLEEVYRDEDGNVIGGKAPSGHEVELIHEESYFFRMSKYAD
QLVEYYEEHPEFIQPESRKNEMLRNFIEPGLEDLAVSRTTFNWGIPVNSDPKHVVYVWID
ALSNYITALGYGSDDETNFEKFWPADVHMVGKEIVRFHTIYWPIMLMALGLPLPKQVFAH
GWLLMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLLRSVPFGSDGVFTPEDFISRVNYD
LANDLGNLLNRTIAMINKYCDGIVPDYASKVTPYDSELSTTAANVVGRYREAMDKMEFST
ALSEVWTLIARANKYIDETEPWKLAKEEDKNAELNSVMVHLAESLRITAILLQPVMIETS
TKIFKQLGLDEEPKKLQELRFGEFPSDTKVVSKGDPIFPRLDADTEVAYIQNKMAEGTQS
NDESVKWDPEETELVSEKDKQIKYEDFDKVELKVAEVIDCKKVEDADKLLQFRLACGDSQ
DRQILSGIAEFYPDPNALIGTKVIIVANLKPRKMRGQISQGMILSAEDPETGKLKVVEAP
KGMPNGAIIS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaaaggcactttttatattactacgccgatttattatcctagcggtcaatta
catatcggaaattcctatacaacaattgcttgtgatgcaatggctcgttataaacgacta
atgggttttgatgtattttatttgactggcgtagatgaacatggagaaaaaattgaaaaa
aaagccgaagaattaggcgtagcgccacaagactatgtagataaaatggcggtagatatc
aaaaaattatggaagactttaggtattagctatgataaatttattcgtacgacagatgat
tatcatcaagaagcagtccaaaagattttccaacaactactagaccaaggagatatctat
ttaggagagtatgaaggctggtactctgtttctgatgaagaattttttactgaaacacaa
ctagaagaagtttatcgggatgaagatggcaatgttatcggtgggaaagctcctagtggt
cacgaagttgagttgattcacgaagaatcctactttttccgtatgagtaaatatgcggac
caacttgtagaatactatgaagaacacccagaatttatccaaccagagtcacgcaaaaac
gaaatgttacgcaatttcatcgaacctggtttagaagatttagctgtgtctagaacaacc
tttaattgggggattccggtaaattctgaccctaaacacgtggtttacgtttggattgat
gctttatctaactatattactgctttaggatatggctcggatgatgaaacgaattttgaa
aagttttggcccgccgatgtccatatggtaggaaaagagattgtacgcttccatacgatt
tattggccaattatgttaatggctttgggacttcctttaccaaaacaggtttttgcccat
ggttggttgttaatgaaagatggaaaaatgtctaaatctaaaggaaatgttgtttatcca
gaaatgttagtagaacgttatggtttagatcctttgcgttactatcttttgcgttctgtt
ccttttggtagcgatggcgtctttactccagaagactttatttccagagtgaactatgat
ttagccaatgatttggggaacttgttgaatcggacaattgctatgattaataaatattgt
gatggtattgtgccagattatgcttcaaaagtaacaccttatgacagtgaattatcaact
acagctgctaatgtcgtagggcgctatcgtgaagctatggataaaatggaatttagtact
gctctttcagaagtatggacgctaattgctcgtgccaataaatatattgatgaaacagag
ccttggaaattagccaaagaggaagataaaaacgcagaattaaatagcgtaatggttcat
ttggctgaaagcttgcggattacagctattttgttacaacctgtcatgatcgaaacctca
acgaaaattttcaaacaactaggtttggatgaagaacctaaaaaactacaagaactacgt
tttggtgaatttcctagtgatacgaaagtagttagtaaaggcgatcctatcttcccacgt
ttagatgcagatactgaagttgcttatatccaaaataaaatggcagaaggcacacaaagt
aatgatgagtctgtgaaatgggatccagaagaaacagaattagtctctgaaaaagacaag
caaatcaaatacgaggattttgataaagttgaattaaaagtagctgaagtgattgattgc
aaaaaggtagaagacgctgataagctattacaatttcgcttagcttgtggggatagccag
gaccgacaaattttatcagggatcgctgaattttaccctgatcctaatgcattaattggg
acaaaagtaatcattgttgctaacttgaaaccacggaaaatgcgtggacaaattagccaa
ggcatgattctttcagctgaagatccagaaacagggaaattaaaagttgttgaagctcct
aaaggcatgcctaacggtgcaataatttcatag

DBGET integrated database retrieval system