KEGG   Tetragenococcus osmophilus: C7K38_08755Help
Entry
C7K38_08755       CDS       T05711                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
too  Tetragenococcus osmophilus
Pathway
too00620  Pyruvate metabolism
too01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:too00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C7K38_08755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:too02000]
    C7K38_08755
Enzymes [BR:too01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     C7K38_08755
Transporters [BR:too02000]
 Other transporters
  Primary active transporters [TC:3]
   C7K38_08755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Amidohydro_1 His_biosynth TGT
Motif
Other DBs
NCBI-ProteinID: AYW48939
UniProt: A0A3G5FF52
Position
1791459..1792862
Genome map
AA seq 467 aa AA seqDB search
MSENKKIKLMETVLRDAHQSLMATRMSTEDMLPIVEKLDKVGYEALECWGGATYDAAIRY
LNEDPWQRLREIRKRAKNTKLQMLLRGQNLLGYRNYADDVVESFVAKAAEAGIDVFRIFD
ALNDVRNLETSLKAVQKANKHAQLVLCYTISPVHTVDYYRDLAKELVDMGADSLCVKDMA
GIMTPEVAKELVSELKKVVDVPVEIHTHSTSGTSEMTYLESVKAGADIIDTAISPFAGGT
SQPASETLAYALKEYGYELDVDMDLMEEIADYFKPIKQKYVDEGVFDYKMMDVEPNALFY
QVPGGMLSNLYSQLKQANATDKYEDVLKEVPAVRKDLGYPPLVTPMSQMVGTQAVFNVLA
KERYKMVPNEIKNYIRGEYGKSPAPVDKTVQENIIGDEEVITERPADRLQPEMESLAAEL
GDLAKTEEDVLTYALFPQIGLTYLKNKYAPKSENNDDGITKIKVTQV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaataaaaaaatcaagttaatggaaactgtcttaagagacgctcatcaaagt
ttaatggctactagaatgtcgacagaagacatgcttccaattgttgaaaaattggataaa
gtgggctatgaagcattagaatgttggggtggagcgacttatgacgcagctatccgttac
ttaaatgaagacccttggcaaagattgcgagaaattcgtaaacgagcaaaaaatactaaa
ctacaaatgttgttgcggggacaaaacttattaggttatcgtaactacgctgatgatgta
gtagaaagttttgttgctaaagctgctgaagctggaatcgatgttttccgaatttttgac
gctttaaatgatgtaagaaatttagaaacttcgcttaaagctgtccaaaaggctaataaa
catgctcaacttgttctttgctatacaattagccctgttcatactgtggattattatcgt
gatctagcaaaagaattagtagacatgggcgctgattcactttgtgtaaaagatatggca
gggattatgactcctgaagttgccaaagaattagttagtgaattgaagaaagtcgttgat
gttcctgtagaaattcatactcattcaacgagtggcacttcggaaatgacatatctagaa
tctgtaaaagcaggtgctgatatcattgatacagccatttctccttttgcaggcggaaca
agccaaccagcttctgaaacgttagcttatgctttaaaagagtatggctatgaattagat
gttgatatggatctaatggaagaaattgctgattacttcaaaccgatcaaacaaaaatac
gtcgatgaaggtgtttttgattacaaaatgatggatgtagagccaaatgctttattctat
caagtgccgggtggtatgttatctaatctttattctcaacttaaacaagcgaatgctaca
gataaatatgaagatgttcttaaagaagtacctgcagtccgcaaagacttaggttatcca
ccgttagtaacaccgatgagccaaatggtaggaacacaagctgtctttaatgtattggca
aaagaacgttacaagatggttcctaatgaaattaaaaactatattcgcggagaatatgga
aagtctccagctccagtggataaaactgtgcaagaaaatatcattggtgacgaagaagtt
attacagaacgtccagctgatcgcttacaaccagaaatggaatcattggcagctgaatta
ggtgatttagccaaaacagaagaagatgtattgacttatgcattgttcccacaaattgga
ctaacttatctaaaaaataaatatgcaccaaaatcagaaaataatgatgatggcattact
aaaattaaagttacacaggtataa

DBGET integrated database retrieval system