KEGG   Thermodesulfobacterium geofontis: TOPB45_1445Help
Entry
TOPB45_1445       CDS       T01547                                 

Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00450  Selenocompound metabolism
top01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:top00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TOPB45_1445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:top03016]
    TOPB45_1445
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     TOPB45_1445
Transfer RNA biogenesis [BR:top03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    TOPB45_1445
 Prokaryotic type
    TOPB45_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AEH23524
UniProt: F8C333
Position
1441899..1442954
Genome map
AA seq 351 aa AA seqDB search
MQEIKLTQMTKASGUAAKLPQEFLVEILKDLEIPSHPYLIQSFEYGADAAIFKINENTAL
IFSADFFTPVIDDPFVFGQISAANALSDIYVCGGKPLLALNLICFPKKGIPKEILKKILE
GGLSKIKEAGAFLVGGHSIDDPEPKYGLAVVGIAHPEKIISNKNAKEGDLLYLSKPIGLG
ILVTAYKGNLLDEKSNIYKAMIKTMTELNNKIAEILLELDIKAATDITGFGLLGHALEMA
IASKKDLIIYAHRVPYFKEAKDFIEMGIIPEGDYNNLNYCKKNVEIHPEVSENDLILLCD
AQTSGGFLIAVPQEKQEVFEKKAIDAGLNNLALIGEVKNPEGHCPTVRVYP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaaattaaacttacccaaatgactaaagcttcaggttgagcagcaaaacttcca
caagagtttcttgtggaaatattaaaagatcttgaaataccctctcatccctatttaatc
caaagttttgaatatggtgccgatgctgctatttttaaaattaatgaaaacactgctctt
atcttctcagcagattttttcactccggtaattgatgatccttttgtctttgggcagata
tctgctgctaatgccctatctgatatttatgtatgcggaggtaaaccacttttggcctta
aatctcatctgctttcctaaaaagggtataccaaaagaaatacttaaaaaaattttagaa
ggtggactttctaaaataaaagaagctggagcatttcttgtgggtggacatagtattgat
gatccagaacctaaatatggcttagctgttgttggaatagctcatccagaaaaaattatt
agcaacaaaaatgctaaagaaggcgatttactttatctttctaaacccattggtttagga
atacttgtcactgcttataaaggaaatcttttagatgaaaagagtaatatctataaagct
atgataaaaactatgacagaacttaataataaaatagctgaaattttacttgaacttgat
ataaaagcagcaacagatattacaggatttggacttttaggacatgccttggaaatggca
attgcaagtaaaaaagatttaattatttatgctcatagggtcccctattttaaagaagca
aaagattttattgaaatggggattattccagagggagattataacaatttaaattattgt
aaaaaaaatgtagaaatccatcctgaggtttcagaaaatgatcttattctactttgtgat
gcccaaacttcaggaggttttttaatagctgtgcctcaagaaaaacaggaagtttttgag
aaaaaagcaatagatgcaggacttaataacttagctcttatcggagaggttaaaaaccca
gaaggtcactgccccactgtaagagtatatccttaa

DBGET integrated database retrieval system