KEGG   Thalassolituus oleivorans R6-15: R615_02525Help
Entry
R615_02525        CDS       T03056                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00230  Purine metabolism
tor00250  Alanine, aspartate and glutamate metabolism
tor01100  Metabolic pathways
Module
tor_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    R615_02525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    R615_02525
Enzymes [BR:tor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     R615_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHK14949
UniProt: W8FYP4
Position
556206..557498
Genome map
AA seq 430 aa AA seqDB search
MGKCVVVLGTQWGDEGKGKIVDLLTEKAAAVVRFQGGHNAGHTLVIDGVKTALHLIPSGI
LRDGVTCVIGNGVVLAPDALLKEVRALEERGVPVMERLRISHACPLILPYHCALDQAREI
KRGNDKIGTTGRGIGPAYEDKVSRRGLRVGDLYQPEFADKLKEVMEYHNFSLKHYYGVEE
VSYEETLASCIDWAEQIKDIVVDAVDLVHSVRESGGDIMFEGAQGTLLDIDHGTYPFVTS
SNTTAGGVATGSGVGPLYLDQILGITKAYTTRVGSGPFPTELFDSVGIHLATVGKEKGTT
TGRDRRCGWFDAMLVKHAIRVNSINTICLTKLDVLDGLETIKVCVGYQDENGNALKVPAS
ADQFCKLTPVYKELPGWTESTFGAKTIEELPENARSYIRFIEEAIGAPIDIISTGPDRVE
TIVLRHSFDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatgcgttgtagttttgggcacccaatggggtgacgaaggtaaaggtaaaata
gttgacctgctaactgaaaaagcagcagctgttgtacgctttcaaggtggtcacaatgct
ggccacacgctggtgattgatggtgttaaaaccgctcttcacttgattccttctggtatt
ttacgtgatggcgttacgtgcgttattggtaatggtgtggttttggctccggacgctttg
ttaaaagaagtccgtgcgttggaagagcgtggcgtacccgtaatggaacgtttgcgtatc
tctcatgcttgtccgctgattttgccgtatcactgcgcactagatcaggcgcgtgaaatt
aagcgtggcaacgataaaatcggtactacgggtcgtggtattggccctgcgtacgaagat
aaagttagccgtcgcggtttgcgtgttggcgacctgtatcagcctgaatttgccgacaag
ctaaaagaagtgatggaatatcataacttctcgctgaagcattattacggcgtggaagaa
gtgagctatgaagaaaccttagcatcatgcatcgactgggctgaacaaattaaagacatc
gttgtcgatgctgttgatttggtacatagcgtgcgtgaaagcggcggcgatatcatgttt
gaaggtgctcaaggtacgctgcttgatatcgaccatggtacttatccatttgttacctct
tcaaacactaccgcaggcggtgtggcgacaggttcaggtgtgggtcctttgtatttggat
cagatcttaggtatcactaaggcatacacgactcgtgtcggttctggccctttcccaacg
gaattgttcgattcagtcggtattcacttggcgactgttggtaaagaaaaaggcactacg
actggtcgtgatcgtcgttgtggttggttcgatgccatgttggttaagcacgctatccgt
gtgaactcaatcaacaccatatgtctgactaagctcgatgtattggatggcttagaaacc
atcaaagtatgtgttggctatcaagacgaaaatggcaatgcattaaaagtaccggccagt
gcagatcagttctgtaagctgacgcctgtgtacaaagagttaccaggttggacggaatct
accttcggtgcgaaaaccatcgaagagctgccagaaaacgcgcgcagctatatccgtttt
attgaagaagcaattggtgctcccattgatattatttctaccggtcctgatcgtgtagaa
accattgtattgcgtcacagctttgatctgtaa

DBGET integrated database retrieval system