KEGG   Thalassolituus oleivorans R6-15: R615_04175Help
Entry
R615_04175        CDS       T03056                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00620  Pyruvate metabolism
tor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R615_04175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tor02000]
    R615_04175
Enzymes [BR:tor01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     R615_04175
Transporters [BR:tor02000]
 Other transporters
  Primary active transporters [TC:3]
   R615_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 ADH_zinc_N RnfC_N DUF5315
Motif
Other DBs
NCBI-ProteinID: AHK15180
UniProt: W8FVP9
Position
904350..906116
Genome map
AA seq 588 aa AA seqDB search
MSDSKKPLGITDVVLRDAHQSILATRMRIDDMLPIAAKLDQVGYWSLESWGGATFDSCIR
YLGEDPWDRIREFKKAMPKTKQQMLLRGQNLLGYRHYADDVVEKFVERAATNGVDVFRVF
DAMNDPRNLETALKAVKKNGGHAQATLSYTTSPVHTLEAWVSLAKQIEDMGADSIAIKDM
AGVLTPYNAYELVSRLKAQTDLEVQLHAHATAGLSDMTILKAVEAGIDRVDTAISSMSMT
YGHTATESVVAALAGTDRDTGIDLLLLEEIAAYFREVRKKYSKFEGALRGTDSRILVAQV
PGGMLTNMENQLREQGASDKFDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGE
RYKSISKETQGILKGEYGAAPAPMNAELQARVLDGKEAITCRPADLIDAEMDQVLADVKK
LAEEKGFKLAENAIDDALTLAMFPQVAPKFLANRGNPDAFEPAPSAAGADTYTINIDGNE
YVVKVNEGGDVTNLAPVNGAPMSIGGASSTAAPVAAGGGDPITSPLAGNIWKVLVQPGDE
VAEGDVVLILEAMKMETEIRAPKDGTIGSVSAKEGTAVKVGDTLYTLG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattctaagaaacctttaggtatcacagacgtcgttcttcgcgacgcacaccag
tctattctggccacccgcatgcgtattgacgacatgcttcccatagctgccaaactcgat
caagtaggctactggtcacttgagtcttggggcggtgcaacgtttgactcttgcatacgc
tacctcggtgaagatccatgggatcgtatccgtgagtttaaaaaggcaatgccaaaaact
aagcagcaaatgttgcttcgtggtcagaacctgctgggctatcgtcactacgctgacgat
gttgtggagaaattcgtagaacgtgctgctaccaatggtgtagacgtatttcgcgtgttc
gatgcaatgaacgatccgcgcaatcttgaaactgctcttaaagcagttaaaaagaacggc
ggtcatgcacaagcgaccttgtcttataccactagcccagttcatacgctggaagcatgg
gtaagcttggcaaaacaaattgaagatatgggtgcagactccattgctattaaagatatg
gctggtgtactgactccatataatgcatatgaattggtttctcgccttaaggctcagacc
gaccttgaagttcagttgcacgcacatgcgacggctggcttgtctgatatgactattctg
aaagccgttgaagccggtattgaccgtgttgatactgccatctcctcaatgtcgatgact
tatggtcacacggcaacggaatcggttgttgctgctttggctggtactgatcgcgacaca
gggatcgacctgttgttgctagaggaaattgctgcttacttccgtgaagttcgtaagaag
tattctaagtttgaaggtgctctacgcggcactgattctcgtatcttggttgctcaagta
ccaggcggtatgttgaccaacatggaaaaccaactgcgcgagcagggtgcttctgacaag
ttcgacgaagtattgaaagaaatcccgcgcgtgcgtgaagatcttggttttattcctcta
gtaacgcctacttctcagatcgttggtactcaagcagtactgaacgttttgacgggtgag
cgttacaagtcgatctcaaaagaaactcaaggcatcctgaaaggtgaatacggtgcggct
cctgcgcctatgaatgccgagttacaagctcgcgttctggatgggaaagaagccatcacg
tgtcgtccagccgatttgatcgatgctgaaatggatcaagtgttagcagacgttaagaaa
ctggctgaagagaaaggcttcaagttggctgaaaatgccatcgatgacgcgctgactctg
gctatgttcccgcaggttgcgccaaagttcttggccaatcgtggtaatccagatgcgttc
gaaccagcaccaagtgctgcaggtgctgatacctacacgatcaacattgatggcaacgag
tacgttgttaaagttaatgaaggtggtgatgttacaaatcttgctccggtgaatggcgca
cctatgtctataggtggtgcttcttcaacggctgcacctgttgctgcgggtggcggtgat
ccaattacttcgccattggcaggtaatatttggaaggtattggttcagccaggtgatgaa
gttgcagaaggcgacgtcgtactgattctggaagccatgaaaatggaaactgagattcgc
gcaccgaaagacggcaccattggcagtgtttctgccaaagaaggtacggccgttaaagtg
ggcgacactctgtataccctaggttaa

DBGET integrated database retrieval system