KEGG   Thalassolituus oleivorans R6-15: R615_07080Help
Entry
R615_07080        CDS       T03056                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00030  Pentose phosphate pathway
tor00480  Glutathione metabolism
tor01100  Metabolic pathways
tor01110  Biosynthesis of secondary metabolites
tor01120  Microbial metabolism in diverse environments
tor01130  Biosynthesis of antibiotics
tor01200  Carbon metabolism
Module
tor_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R615_07080
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    R615_07080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tor04147]
    R615_07080
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     R615_07080
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     R615_07080
Exosome [BR:tor04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   R615_07080
  Exosomal proteins of colorectal cancer cells
   R615_07080
  Exosomal proteins of bladder cancer cells
   R615_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHK15609
UniProt: W8G0G2
Position
1502190..1503647
Genome map
AA seq 485 aa AA seqDB search
MHINAPYELVLFGGLGDLALRKLMPALYLLYRDGRLPSGRIFAATRQTLEREDFLGRIEK
ALKSHLPSEYLELATWEGFSQCLHCLTIDLNSSQGYLDLATTLGSDDPNRVYYLATGSDL
YTPICQGLHDSGLIKSNSKIVLEKPIGHDYESASAINNIVSEYFDECQIYRIDHYLGKET
VQNLMVLRFANSLFESQWNQHYIDHIQITISESIGVEKRAEFYEQVGAMRDMFQNHLLQL
LCITAMEPPARLDPDSVRDEKVKVLRALKPIVGNHISDNVVRGQYDAGVAEGKPVPRYRD
EPGVHPKSMTETFVAVKVEIDNWRWAGVPFYLRTGKRLAERACEIVVHFKEIPHSIFPLQ
HKSTMANKLVFRLQPDEGVRLMLCEKRVGPGMNVRPMNLSLNPANHKQTRVPEAYERLLF
DVLSGNATLFLRDDELLEAWRWVDPILSYWEEIEQRPEPYTSGSWGPAAATLLLAKEGRL
WDENS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcacattaatgcaccatatgagctggtgttatttggcgggcttggagatttagcatta
cgtaagttaatgccggcgctatatctactgtatcgagatggtcgtttacccagcggacgt
attttcgccgccactcgccaaacactagagcgcgaggatttcttagggcgtatcgaaaaa
gcgctcaaatcacatctgccatctgaatatttagaattagcaacgtgggaaggttttagc
cagtgcctgcattgcttgacgattgatcttaatagctcgcaaggttatctcgatctcgct
acgacattgggcagcgatgatccaaatcgtgtgtattatctagcaacaggttccgatctt
tatactcctatttgccaagggctacacgatagtgggttgatcaaaagcaacagtaaaatc
gtcctcgaaaaacccatcggccatgattacgaatcggcatctgccattaataatatcgtt
tctgaatattttgatgaatgtcagatttatcgtattgatcattatttaggtaaagagacg
gtacaaaatctaatggtgctgcgctttgccaattcattgtttgagtcgcaatggaatcag
cattatatcgatcatatacaaatcactatttcagaatctattggagtcgagaagcgcgcc
gagttttacgagcaagtgggtgcaatgcgcgatatgtttcaaaatcatctgctgcaattg
ctgtgtatcacggcaatggagcctccggctcggttagatccggattctgtacgcgacgaa
aaagtaaaagtattgcgcgccttaaaaccgattgttggcaatcatattagcgataacgtt
gttcgcggccagtacgatgccggtgttgctgagggcaagccagttccacgctatcgagat
gagccgggcgtacatcctaaaagcatgactgaaacttttgtcgcggtaaaagtcgaaatt
gataactggcgttgggcgggggttccattttatttacgtacaggtaaacgtctggctgag
cgagcatgcgagattgtggtgcattttaaagaaataccgcactcaatatttccattgcaa
cataaaagcactatggctaataaattggtgtttcgtctgcaaccggatgaaggcgtgcgc
ttaatgttgtgcgaaaaacgcgtaggcccaggtatgaatgtgcgaccaatgaatttaagt
ttaaatcctgcaaatcataagcaaacccgagtgccagaggcttacgagcgcttgttgttc
gatgtgttgagcgggaatgcgactttatttttacgtgatgatgaattactagaagcgtgg
cgttgggttgatcctattttaagctattgggaagaaatcgaacaacgtccagaaccctat
acttctggctcttggggtccagcagcagccacattgctgttagcgaaagaagggcggtta
tgggacgaaaatagctaa

DBGET integrated database retrieval system