KEGG   Thalassolituus oleivorans R6-15: R615_16050Help
Entry
R615_16050        CDS       T03056                                 

Definition
(GenBank) acetyl esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00903  Limonene and pinene degradation
tor00930  Caprolactam degradation
tor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    R615_16050
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    R615_16050
Enzymes [BR:tor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     R615_16050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Peptidase_S9 UPF0227 DUF3089
Motif
Other DBs
NCBI-ProteinID: AHK16921
UniProt: W8FZS3
Position
3462224..3463105
Genome map
AA seq 293 aa AA seqDB search
MPSFLARATRLFVSQVVKRQLGPKVSIASQRKRLDALQRVIPMPNGVKEEECHLGNIPAR
SYTPAMDSGAILYLHGGAYTIGSPVSHREMVARISRQTEHKGYLIDYRLAPESLFPAAVE
DALEAYIALLAEHQNIVVMGDSAGGGLTLALMQAIRAGEYAEPAALVLLSPWADLTCSGD
SIERCAAIDPMLSAEWLNTSAKIYAGEESLSHPQISPLFSDFTDYPRTLIQVGTDEILLD
DARRVAYAIKQAGNEVVLQEFADMWHVFQIHGSYMPESRGAIRAIANFLKGDK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctttttagcacgggcgactcgcctatttgtcagccaagtggtgaaacgccaa
ttaggacctaaagtgtccattgcctctcaacgcaaacgcttagatgcattacagcgcgtt
attccaatgcctaacggtgttaaagaagaagagtgccacttaggcaatattccagcacgt
agttacacacctgcgatggacagcggcgcaattctatatttacacggcggagcctacact
attggctcaccggttagtcatcgggaaatggtcgctcgaatatcgcgtcagactgaacat
aaaggctacttaatcgattatcgcttagcacctgagtcattattcccagccgcagtggaa
gatgccctagaagcatatatagcgttgttggcagagcatcaaaacatcgttgttatgggc
gactcggccggtggcggcctgaccctcgcacttatgcaagcgattcgcgctggcgaatac
gccgaacccgcggcgttagtcttgctgtctccttgggcagacttaacttgcagcggtgac
agcatagagcgttgcgcggccatcgatccgatgctcagcgctgagtggttaaatacatcg
gcgaaaatatacgccggtgaagaatcactaagccacccgcaaatatcgccgctgttcagc
gatttcacggactatccgcgcacactaattcaagtaggaacagatgaaatactacttgat
gacgcccgtcgagttgcctatgcaatcaagcaggctgggaatgaagttgttttacaggaa
tttgccgacatgtggcatgtatttcaaattcacggcagctatatgccggaatcacgcgga
gcaataagagcaatagcaaatttcttaaaaggcgataaatag

DBGET integrated database retrieval system