KEGG   Thermus oshimai: Theos_0132Help
Entry
Theos_0132        CDS       T02346                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tos  Thermus oshimai
Pathway
tos00020  Citrate cycle (TCA cycle)
tos00310  Lysine degradation
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01130  Biosynthesis of antibiotics
tos01200  Carbon metabolism
Module
tos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theos_0132
  Amino acid metabolism
   00310 Lysine degradation
    Theos_0132
Enzymes [BR:tos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Theos_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFV75215
UniProt: K7QXN5
Position
complement(120917..122113)
Genome map
AA seq 398 aa AA seqDB search
MKELVVPSVGESIVEVEIGAWLKKEGEAFRQDEPLVELITDKATLELPAPFVGTLKRILK
RTGETARVGEAIALLEEGTAQSAPAPKPEEAREAEGPLAMPAAERLMAEKGVAPEAVPGT
GLGGRILKEDVLRHLETAPRPEPAPPPPPPVQTPPPPTAPPAEKPWRVDEAVPMTPLRRR
IAERLLQARQTTAMLTTFNEADMSAVIALRKELGEAFQKKHGVKLGFMSFFVKAVVQALK
EIPELNAEIRDGYIVYHRYYDIGIAVGGGEGLVVPVLRDADRLSFAEIERQIADFAERAR
TKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVAREGQVVIRPM
MYLALSYDHRIVDGREAVTFLRRVKELIENPVRLLLEV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggagcttgtggtgccctctgtgggcgagtccatcgtggaagtggagatcggcgct
tggctcaagaaggagggcgaggccttccggcaggatgagcccttggtggagctcatcacc
gacaaggccaccttagagcttcccgcccccttcgtgggcacgctgaagcggatcttgaag
cgcaccggggagacggcccgggtgggggaggccatcgccctcctggaggagggaacagcc
caaagcgcccccgcgcccaagcccgaggaggcccgggaggcggaaggccccctggccatg
cccgcggccgagaggctcatggcggaaaagggcgtggcccccgaggcggtccccggcacg
ggcctcggcgggcggatcctgaaggaggacgtcctccgccacctggaaaccgcccccagg
cccgaacccgccccgcccccgccaccccctgtccagaccccgccgccccccaccgcaccc
cctgcggagaagccctggcgggtggacgaggccgtgcccatgacccctctccgccgccgc
atcgcggaaaggctcctccaggcccgccagaccacggccatgctcaccaccttcaacgag
gcggacatgtccgcggtcatcgccttgaggaaggagctcggggaggccttccagaagaag
cacggggtgaagctgggcttcatgagcttcttcgtgaaggcggtggtccaggccctgaag
gagatccccgagctcaacgcggagatccgggacgggtacatcgtctaccaccgctactac
gacatcggcatcgccgtggggggcggcgagggcctggtggtgcccgtcctaagggacgcg
gaccggctttccttcgcggagatcgaacggcagatcgcggacttcgccgaacgggcccgc
accaagaagctcaagcccgaggagctcatggggggcaccttcaccatcaccaacgggggg
atctacggctccctaaactccacccccctcctgaacccgccccaggtgggcatcctgggc
atgcacgccatccaggagcgccccgtggcccgggaggggcaggtggtgataaggcccatg
atgtacctggccctctcctacgaccaccgcatcgtggacgggcgggaggcggtgaccttc
ctccgccgggtgaaggagctcatcgaaaaccccgtgcggctcctcctggaggtgtga

DBGET integrated database retrieval system