KEGG   Thermus oshimai: Theos_0143Help
Entry
Theos_0143        CDS       T02346                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tos  Thermus oshimai
Pathway
tos00010  Glycolysis / Gluconeogenesis
tos00052  Galactose metabolism
tos00500  Starch and sucrose metabolism
tos00520  Amino sugar and nucleotide sugar metabolism
tos00521  Streptomycin biosynthesis
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01130  Biosynthesis of antibiotics
tos01200  Carbon metabolism
Module
tos_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theos_0143
   00052 Galactose metabolism
    Theos_0143
   00500 Starch and sucrose metabolism
    Theos_0143
   00520 Amino sugar and nucleotide sugar metabolism
    Theos_0143
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theos_0143
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Theos_0143
Enzymes [BR:tos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theos_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AFV75226
UniProt: K7QTJ8
Position
130308..131213
Genome map
AA seq 301 aa AA seqDB search
MTVVGLDLGGTKIAAGAFDGERLLSEVVLPTPKEGGMRVVEALAEAALRAEAEAGVRAEA
FGLGTPGPLDFARGLIRFTPNIPGLKDFPIRDLLRERLGRPVHLENDANAAALAEHHLGA
ARGEESSLYLTVSTGIGGGVVLGGRVLRGVRGQGGELGHITLLPGGPACGCGLEGCLEAL
AAGRALEREAGYAYGLPVDTRELFRRYGAGDPKAERILLQAARYVGLGLASLVKAFDPGA
VVVGGGVALNAPEGYWQALEGAYRHYLQGWEVPPLRKALLGARAGLLGAALTAYLEGDGA
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggtggggctggacctgggggggaccaagatcgccgcgggggcctttgacggg
gaaaggctcctttcggaggtggtcctccccacccccaaggagggggggatgcgggtggtg
gaggccctggcggaggccgccctacgggcggaggccgaggccggggtgcgggcggaggcc
tttgggcttggcaccccggggcctttggacttcgctaggggcctcatccgcttcaccccc
aacatcccagggcttaaggacttccccatccgggacctcctgagggaaaggcttggccgc
cccgtccacctggaaaacgacgccaacgccgccgccctcgccgagcaccacctgggggcg
gcccggggggaggagagctccctctacctcaccgtgtccacggggatcgggggcggggtg
gtcctgggggggcgggtcctccggggggtgcgggggcaggggggggagctcggccacatc
accctcctccccggggggcccgcctgcgggtgcggcctcgagggctgcctcgaggccctg
gccgcgggccgggccctggagcgggaggcgggctacgcctacgggcttccggtggacacc
cgcgagctcttccgccgctatggggcgggggaccccaaggcggagcgcatcctcctccag
gccgcccgctacgtgggcctgggcctggccagcctggtgaaggcctttgaccccggggcg
gtggtggtgggcgggggggtggccctgaacgcccccgagggctactggcaggccctggag
ggggcctaccgccattaccttcagggctgggaggtgccccccctcaggaaggcccttttg
ggagcccgggcggggcttctgggggcggccctcacggcgtatcttgagggggatggagct
cggtaa

DBGET integrated database retrieval system