KEGG   Thermus oshimai: Theos_2037Help
Entry
Theos_2037        CDS       T02346                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tos  Thermus oshimai
Pathway
tos00330  Arginine and proline metabolism
tos00332  Carbapenem biosynthesis
tos01100  Metabolic pathways
tos01130  Biosynthesis of antibiotics
tos01230  Biosynthesis of amino acids
Module
tos_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Theos_2037
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Theos_2037
Enzymes [BR:tos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Theos_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFV77036
UniProt: K7QWD1
Position
complement(1923017..1924126)
Genome map
AA seq 369 aa AA seqDB search
MRAGLEAKRLVVKVGSAVLAGEGGLERPVMAELARQVALLRRGGREVVLVSSGAVAAGRA
AMGLPRPKDMPLKQALAAIGQPLLMQAWREAFRAEGLEVAQVLLTAEDLAHRERYLNAKA
TLLALLGLGVVPIVNENDTVAFHEIRFGDNDQLSARVAPLVEAGLLVLLSDVEALYEADP
KKNPGARPIPEVASVKEVLTLAGEGNPLGSGGMRSKLLAAGMAARVGIPTLLLPGRRPGV
LLSALRGEPLGTYFHAQRRYRGARAWLYQNLSPKGALVLDEGAVRALRERGASLLPSGVK
EVQGRFGRGEVVRLLSERGEEVGLGLAAYASEEIARIKGRHSREIEAILGYRYTEEVVHR
DHLVLKEEA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgggcctcgaggccaagcggcttgtggtcaaggtggggagcgcggtcctggcc
ggggaggggggcttggaaaggccggtcatggccgagctggcccgccaggtggccctcctc
aggcggggggggcgggaggtggtcctggtctcctcgggggcggtggccgcgggccgggcg
gcgatgggcctgccccgccccaaggacatgcccctgaagcaggccctggcggccatcggc
cagcccctcctcatgcaggcctggcgggaagccttccgggcggagggcctcgaggtggcc
caggtcctcctcaccgccgaggacctggcccaccgggagcgctacctgaacgccaaggcc
acccttctggcccttcttgggcttggagtggtgcccatcgtcaacgagaacgacaccgtg
gccttccacgagatccgctttggggacaacgaccagctctccgcccgggtggcccccctg
gtggaggcggggctcctcgtcctcctttccgacgtggaggccctctatgaggcggacccc
aagaagaaccctggggcgaggcccatccccgaggtggcctcggtgaaggaggtcctgact
ttggcgggggaggggaaccccttggggagcgggggcatgcgctccaagctcctggccgcg
gggatggccgcccgggtggggatccccaccctcctcctcccgggccggcgcccgggggtt
ctcctttccgcccttaggggggagcccttgggcacctacttccacgcccagcgccgctac
cggggggcgcgggcctggctttaccagaacctgagccccaagggggcgctggtcctggac
gagggggcggtgcgggccctaagggagcggggggcgagcctcctcccctccggggtcaag
gaggtgcaggggcggttcgggcggggggaggtggtgcgcctcctttcggaaaggggagag
gaggtgggcctggggcttgccgcctacgcctcggaggagattgcccgcatcaaggggcgc
cacagccgggagatagaggccattctgggctaccgctacacggaggaggtggtccaccgg
gaccacctggttttgaaggaggaggcatga

DBGET integrated database retrieval system