KEGG   Thermus oshimai: Theos_2160Help
Entry
Theos_2160        CDS       T02346                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tos  Thermus oshimai
Pathway
tos00010  Glycolysis / Gluconeogenesis
tos00020  Citrate cycle (TCA cycle)
tos00620  Pyruvate metabolism
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01130  Biosynthesis of antibiotics
tos01200  Carbon metabolism
Module
tos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theos_2160
   00020 Citrate cycle (TCA cycle)
    Theos_2160
   00620 Pyruvate metabolism
    Theos_2160
Enzymes [BR:tos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Theos_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFV77154
UniProt: K7R7Y9
Position
2028283..2029512
Genome map
AA seq 409 aa AA seqDB search
MELRLPELGDNVATATVVGVLVKEGDRVAPGQPVLELETDKAVMEVPAEAGGVVEKVLVK
PGDEVKPGQPFLVLQAEGEAPAPEAPAQEEAPKAEAPQRAEKAQPPAPPTEGRRLVPASP
SVRRLARELGVDIYALRGTGLAGRITEEDVRRAAGLAAPERAIPAPARPPLPDFARFGPV
RREAMSGVRKATLRSMAQAWAQVPMVTHFDEADITDLEALRKRYAPKAEERGFRLTPTAF
LLKALALTLKAFPKFNASIDEEAQEIVYKDYIHIGVAVDTPHGLLVPVIRNVDQKGVFAL
ARELQEISERARARKLTPEEMQGGTFSLSNLGGIGGVGFTPIVNWPEVAILGVSRAQMKP
VWNGEAFVPRLLMPFSLTYDHRLIDGAEAARFCRHLASLLEDPLGLALE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggagctcaggctacccgaactcggcgacaacgtggccacggccaccgtggtgggcgtg
ttggtgaaggaaggggaccgggtggcccccggccagcccgtcctggaactggaaaccgac
aaggcggtgatggaggtgcccgcggaggcgggcggggtggtggagaaggtcctggtgaag
ccaggagatgaggtgaagccggggcagcccttcctggtcctgcaggccgaaggggaggcg
cctgccccggaagcccccgcccaggaagaggcccctaaggccgaggctccccaaagggca
gaaaaggcccaacccccagcccctcccaccgaggggcggcgcctggtcccggcctccccc
tccgtcaggcggctcgcccgggagctgggggtggacatctacgccttaaggggcacgggg
cttgcgggccggatcacggaggaggacgtcaggcgcgcggcgggcctggccgcgcccgaa
cgggccatccccgcccccgctcgtccccccctccccgacttcgcccgcttcggccccgtg
cgccgcgaggccatgagcggggtgcggaaggccacccttaggtccatggcccaggcctgg
gcccaggtgcccatggtcacccactttgacgaagcggacatcaccgacctcgaggccctg
cgcaagcgctacgcccccaaggcggaggagcggggcttccgcctcacccccaccgccttc
ctcctcaaggccctggccctcaccctcaaggccttccccaagttcaacgcctccattgac
gaggaggcccaggagatcgtctacaaggactacatccacatcggggtggccgtggacacc
ccccacggcctcctggtccccgtgatccggaacgtggaccagaagggggtcttcgccctg
gcccgggagctccaggagatctccgaacgggcccgggcccgcaagctcacccccgaggag
atgcaggggggcaccttcagcctctccaacctgggggggatcgggggcgtgggcttcacc
cccatcgtgaactggccggaggtggccatcctgggggtctcccgggcccaaatgaagccc
gtctggaacggggaggccttcgtgccccgcctccttatgcccttcagcctcacctacgac
caccgcctcattgacggggccgaggccgcccgcttctgccgccacctggcctccctcctg
gaagaccccctcgggctcgccctggagtag

DBGET integrated database retrieval system