KEGG   Thermus oshimai: Theos_2474Help
Entry
Theos_2474        CDS       T02346                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tos  Thermus oshimai
Pathway
tos00360  Phenylalanine metabolism
tos00362  Benzoate degradation
tos00620  Pyruvate metabolism
tos00621  Dioxin degradation
tos00622  Xylene degradation
tos00650  Butanoate metabolism
tos01100  Metabolic pathways
tos01120  Microbial metabolism in diverse environments
tos01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theos_2474
   00650 Butanoate metabolism
    Theos_2474
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Theos_2474
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Theos_2474
   00622 Xylene degradation
    Theos_2474
   00621 Dioxin degradation
    Theos_2474
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Theos_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA Ldh_1_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFV77451
UniProt: K7QWZ8
Position
pTHEOS01:complement(270031..270951)
Genome map
AA seq 306 aa AA seqDB search
MDKVKVAILGSGNIGTDLMYKLLKNPGHMELVALVGIDPKSEGLARARALGLEASPEGIA
YILERPEIKIVFDATSAKAHVRHAKLLREAEKIAIDLTPAARGPYVVPPVNLKEHLDKDN
VNLITCGGQATIPLVYAVHRVAPVLYAEMVSTVASPSAGPGTRQNIDEFTFTTARGLEAI
GGAQRGKAIIILNPADPPILMTNTVRAIPEEEGFDREEVVASVRAMEAEVQAYVPGYRLK
ADPVFEKLPTPWGEKTVVSMLLEVEGAGDYLPPYAGNLDIMTASARRVGEVFAQHLLGVR
REEVQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtcaaggtcgcgattctaggctcgggcaacatcggcacggacctcatgtac
aagctcctcaagaaccccgggcacatggagctggtggccctggtggggattgaccccaag
tccgagggcctggcccgggctagggccttaggcctcgaggccagccccgaggggatcgcc
tacattctggaacgcccggagatcaagatcgtctttgacgccaccagcgccaaggcccac
gtgcgccacgccaagctcctgagggaggcggagaagatcgccatcgacctcacccccgcg
gcccgggggccctacgtggtgcccccggtgaacctgaaggaacacctggacaaggacaac
gtgaacctcatcacctgcggcgggcaggccaccatccccctggtctacgcggtgcaccgg
gtggcccccgtgctctacgcggagatggtctccaccgtggcctccccctccgcggggccc
ggcacccggcagaacatcgacgagttcaccttcaccaccgcccggggcctcgaggccatc
gggggcgcccagcgggggaaggccatcatcatcctgaaccccgcagaccctcccatcctc
atgaccaacaccgtgcgggccatccccgaggaggaggggttcgaccgggaggaggtggtg
gcaagcgtccgggccatggaggccgaggtccaggcctacgtccccggctaccggctgaag
gcggacccggtgtttgaaaagctccccaccccctggggggaaaagacggtggtctccatg
ctcctggaggtggagggggcgggggactacctgcccccgtacgcggggaacctggacatc
atgaccgcctccgccaggcgggtgggggaggtcttcgcccagcacctcctcggggtccgg
agggaggaggtgcaggcgtga

DBGET integrated database retrieval system