KEGG   Theileria orientalis: TOT_010000503Help
Entry
TOT_010000503     CDS       T03460                                 

Definition
(RefSeq) ATP-dependent helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
tot  Theileria orientalis
Pathway
tot03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tot00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TOT_010000503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tot03041]
    TOT_010000503
Enzymes [BR:tot01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TOT_010000503
Spliceosome [BR:tot03041]
 Complex C
  Other components
   Step II factors
    TOT_010000503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD T2SSE AAA_19 AAA_7
Motif
Other DBs
NCBI-GeneID: 20713408
NCBI-ProteinID: XP_009689341
UniProt: J4D5L5
Position
1:complement(join(1185233..1185330,1185355..1185497,1185642..1185892,1186080..1186310,1186505..1186634,1186870..1187104,1187251..1187310,1187506..1187715,1187774..1188011,1188498..1188554,1188677..1189713,1190186..1190581,1190699..1190750,1190807..1190934,1190988..1191138,1191312..1191398))
Genome map
AA seq 1167 aa AA seqDB search
MDGLEELQSLSALAKVTEMLKNYLDVDQPELAEFIIFLAKKAKDVEDFNKLLDENEANMS
YDFVNQLYRTIIALDPPKRALIKTIIDEWDEIINRNDDQVNFPALTLKNDPNREELKAPK
IKNELSDWAKELLERENPNIRVCDFGAFVEFETSEGVYDGLVHISQVSEKRKIINIQDVI
KRNQKVYVKVTSIEKHEPSERDSRRKRLKISLTMKNVNQSTGKDTSEESYERGYGSELDT
SKEYEEFELVNNKKRKYMNDIDRWENQQLLKRIVLSPIKLVARPEGSLSRTIASSLAIQH
ENKMMTMKDEQYSEKKEDTSNIMDYYKNAVSTKSRREERRGPERENLVEKRRNLPVYKLK
KEIVEKVIANKILIVIGETGSGKTTQIPQYLHESDFCKYSSFIKLIKSQKKDENREKRVD
NTGNSKSDDSRRDKSKSDDSRRDKSKSDDSRRDKSKSDDSRRDKSNGDDSRRDKSNGDDN
TSGSNRDDGTSGSDRDDNTSTRGNRDDSRLDIRPDRRRDKTGHGRSSDDKTVHGKSIDDR
VEEKRMIGITQPRRVSCISVAKRVSEEMGCILGNEVGYSIRFNDCTSSSTLIKYMTDGML
LREILHDPYLYHYSTIMLDEAHERTISTDVLFALLKETCLKRDDFRLIVTSATLESEKFS
KYFLGAEIFKIPGRFFPVEILHSKEQEMDYLEAALITVLNIHLNEKPGDILVFLTVGQED
IETGCKILNERMKKLENLKPPPLIVLPIYAALPTEVQTQIFMPSPPGTRKCILATNIAEA
SITIDGILYVIDPGLCKVKSYNPKTGMESLVVAPISKANARQRSGRAGRTAPGKCYRLYT
ESTFYEEMLPTPVPEIQRVNLTNVVIILKAMGINDFIHFDFMDRPCNEMLIDALDVLYHL
GALDEEGLLTRVGRKMAQFPMDPTLSKVLLTSIDLDCCSEIITIISMLSVQNIFYRPPDK
KEKSDQSRLRYFQTEGDHLTYLNIYQQWQKNSFSNYYCYQNFLQYRALLKVQEIRKQLIS
ILDHYNFHNFDKRSLDSRGINMNKVERIQKSICSGFFHHSAKRGEESYRTLLDEQNVYIH
PSSSLHRRSPEYVVYHELVLTTKEYMRDLTVIKSKWLLELAPTMFVSSGGDKGKFRGRGV
KKNIKIQPLHNKFDKDQDSWRLSKRRL
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggatggcctggaggaacttcagtcactaagtgcacttgcaaaggtgactgagatgctc
aaaaattatctcgacgttgatcaaccggaattggcggaatttataatatttctggccaag
aaggccaaagatgtcgaggattttaacaaacttctggacgaaaatgaagcgaatatgagt
tacgattttgtaaatcagctgtatcgcacaattatcgcactagacccacccaaaagagcg
ttaattaaaacaattatagatgaatgggatgaaataataaacagaaacgacgaccaagtt
aattttccagcacttacactgaagaatgatccaaacagagaagaattaaaggcaccaaag
ataaaaaatgaattgtcggactgggccaaagagttgttggaaagggaaaacccaaatata
cgagtatgtgactttggagccttcgtagagtttgaaacatcagaaggagtgtacgatgga
ctggtgcatatctcacaagtctcagaaaaaaggaaaataataaacatacaagacgtgata
aagaggaatcagaaggtgtacgtgaaagtaacgtcgatagaaaagcatgagcctagtgaa
agggacagtagaagaaagaggcttaagataagtttaacgatgaagaacgtaaaccagagt
accggaaaggacacttcggaggagtcatacgaacgagggtacgggtcggagctggacacg
agtaaggagtacgaggagttcgagctggtgaacaacaagaagagaaagtacatgaacgac
attgaccggtgggaaaatcagcaactgctcaaaagaattgtactttcgccgatcaagcta
gtagcaaggccagaaggctcactctcgaggaccatcgcatcatcattggcaatacagcac
gaaaataaaatgatgacaatgaaagatgaacagtatagcgaaaagaaggaggacacgagt
aacataatggactattacaaaaatgcagtatcaacaaagagtagaagagaagaaagaaga
ggccctgagagggaaaatttagtggagaagagaaggaacctgccagtgtataagctgaag
aaggagatcgtagaaaaggtgatcgctaataagatattgatagttatcggagagacggga
agcggaaagacgacgcagataccgcagtacctgcacgagagtgatttctgtaaatattca
agcttcataaagttgattaaatcgcagaagaaagacgaaaacagagaaaagagagttgac
aacactggtaatagtaaaagcgatgatagtagacgagataaaagtaaaagcgatgatagt
agacgagataaaagtaaaagcgatgatagtagacgagataaaagtaaaagcgatgatagt
agacgagataaaagtaatggcgatgatagtagacgagataaaagtaatggcgatgataac
actagtggtagtaatagagatgatggcactagtggaagtgatagagatgataacactagc
actcgtggcaatagagatgacagcagactggatatcagacctgatagaagacgtgacaaa
acaggccatggcagaagtagtgatgacaaaacagtccatggcaaaagtattgatgatagg
gtagaggaaaaaagaatgattggaataacgcagcctagaagagttagttgcataagcgta
gcaaagagagtgagtgaggaaatgggttgtatactagggaacgaagtgggatactcaata
aggttcaacgactgcacaagcagttcgacgctgataaagtacatgacagacggaatgctc
ctgagagagatacttcatgacccgtatctgtatcactactcaacaatcatgttggatgag
gcacacgagagaacaatatctacagatgtgttattcgcattattaaaggaaacgtgcctg
aagagggatgatttcaggttgatagtgacctcagcaacactggaaagcgaaaagttcagt
aaatacttcctgggagcggagatatttaaaataccagggaggttcttcccagtggaaata
ctgcacagcaaggagcaggaaatggattacctggaagcagcgctgataacagtgttgaat
atacacctgaacgagaagccaggagacatactggtgttcctgacagtaggtcaggaggac
atagaaacgggatgtaaaatattgaatgaaagaatgaaaaagttggaaaatttaaagccg
ccgccactgatagtgttgccaatatacgcagcgttgccgacagaagtgcaaacacaaata
tttatgccatcgccaccaggaacgaggaagtgtatactggcgacaaacatagcagaagca
tcaataacaatagacggaatactgtacgtgattgatccaggactgtgtaaagtaaagtcg
tataatccaaagacagggatggagagtttagtagtagcaccaatatcgaaagcaaacgca
aggcagagatcaggaagagcaggaagaacagcgccaggaaaatgctatagattgtacaca
gagtcgacattctacgaagagatgttgccaacgccagtgccggaaatacagagagtaaac
ttgactaacgtagtcataatactgaaagcaatgggaataaatgactttatacactttgat
ttcatggacaggccttgcaatgaaatgttgatagacgcactggatgtgttgtatcacctg
ggagctcttgacgaggaagggcttttgacgagagttggaaggaaaatggcacaattccca
atggatccaacactgtccaaggtgctattgacgtcgatagacttggactgctgtagtgaa
atcataacgatcatatcaatgctctcagtgcagaacatattctacagaccgccagataag
aaggaaaagagtgatcagagtagattgaggtactttcaaacggagggggaccatttgaca
taccttaacatataccagcagtggcagaaaaactcgttctcaaactactactgctaccag
aacttcctacagtatcgagcactgttgaaggtgcaggaaataagaaagcagctgatatcg
atattggaccactacaacttccacaactttgataaaaggagtctggacagcagaggcatt
aacatgaacaaggtggaaaggatacaaaagagcatatgcagtgggttcttccaccactca
gccaagaggggcgaggagtcgtacagaacgctgctggatgagcagaatgtgtacatacac
ccgtcctcatcactgcacagaaggagcccggaatacgtagtgtatcacgagttggtgctg
accacgaaggagtacatgagggatttgacggtgattaagtcgaaatggctgctggagttg
gcaccaacaatgttcgtgtcgagcggcggcgacaagggtaagttcagaggcaggggcgta
aagaaaaacataaaaatacaaccgctccacaacaagttcgacaaggaccaggatagctgg
cgtctgtcgaagagaaggctctga

DBGET integrated database retrieval system