KEGG   Theileria orientalis: TOT_040000109Help
Entry
TOT_040000109     CDS       T03460                                 

Definition
(RefSeq) DEAD-box family ATP-dependent helicase
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
tot  Theileria orientalis
Brite
KEGG Orthology (KO) [BR:tot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tot03041]
    TOT_040000109
   03009 Ribosome biogenesis [BR:tot03009]
    TOT_040000109
Enzymes [BR:tot01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TOT_040000109
Spliceosome [BR:tot03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    TOT_040000109
Ribosome biogenesis [BR:tot03009]
 Eukaryotic type
  90S particles
   Helicases
    TOT_040000109
  Pre-60S particles
    TOT_040000109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 20716207
NCBI-ProteinID: XP_009692029
UniProt: J4C911
Position
4:join(231835..232087,232153..232634,232665..232925,232960..233013,233139..233423,233454..233627)
Genome map
AA seq 502 aa AA seqDB search
MSDTSEDAVSSSRDDNLNSKQELSESQQNGNSDYFSNVLFTDLEISEPILRALAEHEFVK
TTEIQAKCIPPLLQGKDVLGKAKTGSGKTLAFLIPLAEVLFQVKFMPRNGTGGLIISPTR
ELSLQIFEVAKDVCKYLPQTLGLVMGGANRKQEADKLVRGVNILIATPGRLLDHMQNTKG
FIYKNLLVFVIDEADRILEIGFEEEINQIIKMLPKNRQTSLFSATHTSNVDDLARLSLKS
PVFLQASADDSATVVGLEQGYVVCEAENRFMLLFTFLKKNLDKKIMVFFSSCNSVKFHDE
LLNYVDIPVKSIHGRKKQSHRLTTYYSFCKATKGFLLCTDVAARGLDIPKVDWIVQYDPP
DDPKDYIHRVGRTARGADGKGKAILFLMPEELGFLHYLKSMNVKISKYDFNLSKIANVQM
QLEKLIEKNYYLNSSSKQAYRSYLHAYMSHSLKNIFNVHSLDLKRVARAFGFSVPPKVDL
NTKPSNRSKSRLMKRHPHKRDN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacttctgaagatgctgtgtcatcttctagagatgacaatttgaattcgaag
caggaattaagtgagtctcagcagaatggaaactcagactatttttccaacgtgcttttt
accgatcttgaaatttctgagcccattttgagggctttggctgaacacgagtttgtcaaa
acaactgagattcaagctaagtgtattcccccgcttttgcagggcaaggacgttttggga
aaggcgaaaacaggctctggaaagacgctcgccttcctgattccactggcagaagtcctg
tttcaggttaaatttatgccgagaaatggcaccggcggcctcatcatctccccaacgagg
gagcttagccttcagatattcgaagttgcgaaggacgtctgcaaatatctgcctcagact
ctgggcctggtcatgggaggcgccaacaggaagcaggaggccgacaagctcgtcagaggc
gtgaatattttaatcgcaacccccggccgtctactcgaccacatgcagaacaccaagggg
ttcatctacaagaacctgctcgtctttgtcattgacgaggccgataggatcctagaaatt
ggatttgaggaggagattaaccaaattattaaaatgttgccgaaaaacaggcaaacttcg
ctcttttcagccactcacacttcaaacgtcgacgacctcgctcgtttgtctctgaaatcg
cctgttttcctccaggcatctgctgacgatagcgccactgtggtcggtttggaacagggt
tacgttgtttgcgaggctgagaacagattcatgttgctcttcacgtttttgaagaagaac
ctcgacaagaagataatggttttcttcagcagctgcaactccgtcaagttccacgacgag
cttctcaactacgttgacatacctgtcaagtccattcatgggcgcaagaaacaatcgcac
cgactcaccacctattactcgttctgcaaggccaccaaaggctttttgctttgtactgat
gttgctgcaaggggtctcgatattcccaaggtcgattggattgttcagtacgaccctcct
gatgaccctaaggactacattcaccgtgtcgggaggactgctcgtggcgctgacggcaag
ggcaaggccattctgtttctgatgcccgaggagctcggctttctccactacctcaagtcc
atgaacgtgaagataagcaagtacgacttcaacctcagcaagattgctaacgtgcagatg
cagttggagaagctgattgagaagaactactacttgaacagctcctcaaagcaggcttac
cgctcgtacctccacgcctacatgtctcacagtctcaagaacatcttcaacgttcactcg
ctcgacttgaagcgtgtcgctcgggctttcgggttctccgtcccacccaaggtcgaccta
aacaccaagccttccaaccgtagcaagagccgtctcatgaagcggcatccgcacaagagg
gataattaa

DBGET integrated database retrieval system