KEGG   Tomitella sp. HY188: FO059_04815Help
Entry
FO059_04815       CDS       T06118                                 

Definition
(GenBank) NDP-sugar synthase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
toy  Tomitella sp. HY188
Pathway
toy00051  Fructose and mannose metabolism
toy00520  Amino sugar and nucleotide sugar metabolism
toy01100  Metabolic pathways
toy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:toy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FO059_04815
   00520 Amino sugar and nucleotide sugar metabolism
    FO059_04815
Enzymes [BR:toy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     FO059_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: QDQ96791
UniProt: A0A516X2F5
Position
1045644..1046801
Genome map
AA seq 385 aa AA seqDB search
MTVQSGQWGTGRARQSAAAPASPSPGRDLAEETDAVILVGGKGTRLRPLTLSAPKPMLPT
AGVPFLTHLLARIRQAGIRRVILSTSFKAEVFEEHFGSGADLGLSIEYITETDPLGTGGG
IRNVLPRIASENVLVFNGDVLGGTDLGGLLETHAQQEADVTMHLVRVGDPRSFGCVPTDE
SGRVTAFLEKTEDPPTDQINAGCYVFRRKVIERIPAGRAVSVEREIFPALLAAGARVFGH
VDASYWRDMGTPEDFVRGSADLVRGIAPSPALDGTRGESLVHASAGVAPGALLIGGTVVG
RGVEVGAGARLDGAVLFDGAKVEAGAVVERSIIGFGARIGPRALIRDAVIGDGADVGARC
ELVGGARVWPGVHLPDGGVRFSTDV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacagtccggacagtggggaaccggccgggcgcggcaatccgcggcggccccg
gcgtcgccctcgccggggcgcgacctcgcggaagagaccgacgcggtgatcctggtgggc
gggaagggcacccgcctgcggccgttgacgctctcggcgccgaagccgatgctgccgacg
gcgggggtgccgttcctgacgcacctgctggcgcgcatccggcaggccgggatccggcgc
gtcatcctcagcacctcgttcaaggcggaggtcttcgaggagcacttcggctccggggcg
gatctgggcctgtccatcgaatacatcacggagaccgatccgctgggcaccggcggcggc
atccgcaacgtcctgccccggatcgcctcggagaacgtcctcgtgttcaacggcgacgtg
ctcggcggcaccgacctgggcgggctgctggagacgcacgcgcagcaggaggccgacgtc
acgatgcatctcgtgcgcgtgggggacccgcgctcgttcggctgcgtgcccaccgacgaa
tcggggcgggtgaccgcgttcctcgagaagaccgaggatccgcccacggaccagatcaac
gccggttgctacgtgttccggcgcaaggtgatcgagcggatccccgcgggacgcgcggtc
tcggtggaacgcgagatcttccccgcgctgctcgccgcgggcgcgcgcgtgttcgggcac
gtcgacgcgtcgtactggcgtgacatgggcacgccggaggacttcgtccgcgggtccgcc
gacctggtgcgtgggatcgcaccatcgccggcgctcgacgggacgcgcggcgagtcgctg
gtgcacgccagcgcgggcgtcgccccgggcgcactgctgatcggcggcaccgtcgtcggg
cggggcgtcgaggtgggggccggggcgcggctcgacggcgcagtgctcttcgacggggcc
aaggtggaggccggcgccgtcgtggagcgttcgatcatcgggttcggcgcccgcatcggg
ccccgcgctctgatccgggacgcggtgatcggcgacggcgccgacgtgggggcgcgatgc
gagctcgtcggcggcgcgcgcgtgtggcccggggtccacctgcccgacggcggggtccga
ttctcgaccgatgtctga

DBGET integrated database retrieval system