KEGG   Tomitella sp. HY188: FO059_06555Help
Entry
FO059_06555       CDS       T06118                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
toy  Tomitella sp. HY188
Pathway
toy00450  Selenocompound metabolism
toy00970  Aminoacyl-tRNA biosynthesis
toy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FO059_06555
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FO059_06555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:toy01007]
    FO059_06555
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:toy03016]
    FO059_06555
Enzymes [BR:toy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FO059_06555
Amino acid related enzymes [BR:toy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FO059_06555
Transfer RNA biogenesis [BR:toy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FO059_06555
 Prokaryotic type
   Other AARSs
    FO059_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QDQ97055
UniProt: A0A516X1U2
Position
1427798..1429642
Genome map
AA seq 614 aa AA seqDB search
MSSSVLTAVAWPYANGPRHIGHVSGFGVPSDVFSRYQRMIGNRVLMVSGTDEHGTPILVQ
ADAEGIAPMDLADRYNRVIVDDLQGLGLSYDLFTRTTTRNHYAVVQELFRTLHKNGYLVP
KTTTGAISPSTGRTLPDRFVEGTCPICGYDGARGDQCDNCGNQLDPADLINPRSKINGET
PKFVESEHWFLDLPALADSLGDWLKGRSGWRPNVLRFSLNLIDDMRPRAMSRDIDWGIPI
PLEGWQDRGDKKLYVWFDAVIGYLSASMEWAARSGEPEAWREWWTDPNAVSNYFMGKDNI
TFHSQIWPSELLGYRGEGAKGGEPGPLGALNLPTEVVSSEFLTMSGSKFSTSRGTVIYVR
DFLRDFGPDALRYFISVAGPETQDTDFTWEEFVRRTNFELANEWGNLVNRSVSMAFKNFG
AIPRPGTVTDADAELLRTAHAAFDTVGADLARSRFRSAAGEAMRVVSAANKYISDTEPWK
LAKDPAQADRLATVLHTSLQVVSDANALLTPFLPHSAQSVHELLGGGGVWAAQPEVREVD
DLVSPSLPEGPVGVGLPAEGRSYPVLMGDYAAEKAVWRRTEVQPGTPLSKPTPLFRKLAP
ELGEAGPEWAPVDK
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctctgtgctcaccgccgtcgcgtggccctatgcgaacgggccccgccacatc
ggccacgtgtccggtttcggggtgccctccgacgtcttctcgcgctatcagcggatgatc
ggcaaccgggtcctgatggtttcgggcacggacgagcacggcacgccgatcctggtgcag
gcggacgcggagggcatcgcgccgatggacctggcggaccggtacaaccgtgtgatcgtg
gacgatctgcaggggctcggtctgagctacgacctgttcacccgcaccaccacgcgcaat
cactacgcggtggtccaggagctgttccgcacgctgcacaagaacggctacctggtgccg
aagaccaccaccggcgcgatcagcccctccacgggccgtacgcttccggaccggttcgtc
gaaggcacctgcccgatctgcgggtacgacggcgcccgcggcgaccagtgcgacaattgc
ggaaaccagctcgacccggcggatctgatcaatccgcgcagcaagatcaacggggagacc
ccgaagttcgtcgagtccgagcactggttcctcgatctgcccgcgctcgcggactcgctc
ggcgactggctcaagggccgctccggctggcggccgaatgtcctgcgcttcagcctcaac
ctcatcgacgacatgcgcccgcgcgccatgagccgcgacatcgactggggcattccgatc
ccgctcgaggggtggcaggaccgcggcgacaagaagctctacgtctggttcgacgccgtc
atcggatacttgtccgcgtcgatggaatgggctgcgcgctccggggaaccggaggcgtgg
cgcgagtggtggacggacccgaacgcggtcagcaactacttcatgggcaaggacaacatc
accttccactcgcagatctggccgtcggagctgctgggctaccggggcgagggcgcgaag
ggcggcgagcccgggccgctcggcgcgctcaacctgcccaccgaggtggtgtcctcggag
ttcctcacgatgagcgggtcgaagttctcgacctcccgcggcaccgtcatctacgtgcgg
gattttctgcgcgacttcggccccgacgcgctgcgctacttcatctccgtcgccggcccg
gagactcaggacacggacttcacctgggaggagttcgtccggcggaccaacttcgagctg
gccaacgaatggggcaacctggtcaaccgctcggtgtccatggcgttcaagaacttcggc
gccatcccgcgtccgggcaccgtgaccgacgcggacgcggagctgctgcgcaccgcgcac
gcggcgttcgacacggtcggcgcggatctggcgcgcagcaggttccgttcggccgccggt
gaggcgatgcgggtggtctcggccgccaacaagtacatctccgacaccgagccgtggaag
ctcgccaaggacccggcgcaggccgacaggctcgccaccgtgctgcacacctccctgcag
gtggtctcggacgccaacgcgctgctcacgccgttccttccgcactccgcgcagagcgtg
cacgaactgctcggcggcggcggggtgtgggcggcgcagccggaggtccgcgaggtcgac
gacctggtttcgccgtcgctgcccgaggggccggtgggcgtcgggctgcccgcggagggg
cgcagttacccggtgctcatgggcgactacgccgcggagaaggcggtgtggcggcgcacc
gaggtgcagccgggcaccccgttgtccaagccgaccccgctgttccgcaagctggccccg
gagctgggggaggccggtccggagtgggccccggtggacaagtga

DBGET integrated database retrieval system