KEGG   Tomitella sp. HY188: FO059_12910Help
Entry
FO059_12910       CDS       T06118                                 

Definition
(GenBank) valine--tRNA ligase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
toy  Tomitella sp. HY188
Pathway
toy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:toy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FO059_12910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:toy01007]
    FO059_12910
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:toy03016]
    FO059_12910
Enzymes [BR:toy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     FO059_12910
Amino acid related enzymes [BR:toy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FO059_12910
Transfer RNA biogenesis [BR:toy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FO059_12910
 Prokaryotic type
    FO059_12910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QDQ98051
UniProt: A0A516X5V6
Position
complement(2831430..2834162)
Genome map
AA seq 910 aa AA seqDB search
MTREPDTAANPGGGPADSLAKSWEPGAVESALYQGWVDAGYFTADPHSDKPPFSIVLPPP
NVTGSLHMGHALDHTLMDALARRRRMQGYEVLWLPGMDHAGIATQSVVEKQLAGEGLTRD
DIGREAFIERVWKWKAESGGTIGGQMRKLGDGVDWSRERFTLDDALARAVQTIFKRLYDD
GLIYRAERLVNWSPVLQTAISDIEVKYEDVEGELVSFRYGSLDDAEPHIVVATTRVETML
GDTAIAVHPDDDRYRDLVGTALPHPFLDRTIPVIADAHVDPEFGTGAVKITPAHDPNDFE
MGVRHALPMPSIMSKTAEIENTGTRFDGMDRFTARVRVREALAEQGRIVEEKRPYLHSVG
HSERSGEPIEPRLSMQWWVRVESLAKASGDAVRAGDTVIHPASQEPRWFAWVDDMHDWCI
SRQLWWGHRIPVWYGPEGQTVCVGPGDTPPEGYVQDPDVLDTWFSSALWPFSTMGWPDAT
DDLAKFYPTSVLVTGYDILFFWVARMMMFGTYVAREDAGDGGVLGPRGQVPFQDVFLHGL
VRDEHGRKMSKSRGNGIDPLDWVERFGADALRFTLARGANPGSDLSVGEGNAQSSRNFAN
KLFNATRFALMNGAKPGGLPPRDRLTAADRWILDRLEQVRAGVDESYERYEFGKAAEALY
HFAWDEVCDWYLELAKVQFAGEGDGSGETGFRAEATRTVLGTVLDALLRMLHPMIPFVTE
TLWKVLTGGESLVIASWPVADADTAADPEAARQVADTQKLITEIRRFRSDQGVKPSQRVP
ARLGALEDAGLVPLEGAVRSLARVTAAEAGFTATASIEVRLSAATVVVDLDTSSTVDLEA
EKRRLTKDLAAAHKELAGTTAKLGNEAFLGKAPEQVVEKIRGRRDVAAADVDRLEARLAE
LGQPAEGGAR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtgagcccgataccgctgcgaacccgggcggtggcccggcagactccctggcg
aaaagctgggagcccggcgcggtcgagtcggcgctctaccagggctgggtggacgccggg
tacttcaccgcggacccgcacagcgacaagcccccgttctcgatcgtgctcccgccgccg
aacgtcaccggcagcctgcacatgggtcacgcgctcgaccacacgctgatggacgcgctt
gcgcgccggcgccgcatgcagggctacgaggtgctgtggctgccgggcatggaccacgcc
ggcatcgcgacgcagagcgtcgtcgagaagcagctcgccggagagggcctcacccgcgac
gacatcggccgtgaggccttcatcgagcgcgtctggaagtggaaggccgagtccggcggc
accatcggcggccaaatgcgcaagctcggcgacggcgtcgactggtcgcgcgagcgcttc
acgctggacgacgcgctggcccgcgcggtgcagaccatcttcaagcgcctctacgacgac
gggctgatctaccgggccgagcggctggtcaactggtcgccggtgctgcagaccgcgatc
tccgacatcgaggtcaagtacgaggacgtcgagggcgagctggtcagcttccgctacggc
tccctcgacgacgccgagccgcacatcgtcgtcgccaccacccgcgtcgagacgatgctg
ggcgacaccgcgatcgccgtgcaccccgacgacgaccggtaccgcgacctcgtcggcacc
gcgctgccgcacccgttcctcgacaggacgatccccgtgatcgcggatgcgcacgtggac
cccgagttcggcacgggcgcagtgaagatcaccccggcgcacgaccccaacgacttcgag
atgggcgtgcggcacgcgctgccgatgccgtcgatcatgagcaagacggcggagatcgag
aacaccggcacccggttcgacggcatggaccgattcaccgcgcgcgtccgcgtgcgcgag
gcgcttgccgagcagggcaggatcgtcgaggagaagcgcccctacctgcacagcgtcggc
cactcggagcgcagcggcgagcccatcgagccgcggctgtcgatgcagtggtgggtgcgc
gtggagagcctggccaaggcgtccggcgacgccgtgcgcgccggcgacaccgtgatccac
ccggcctcccaggagccgcgctggttcgcctgggtcgacgacatgcacgactggtgcatc
tcccgtcagctgtggtgggggcaccgcatccccgtctggtacggcccggagggacagacg
gtgtgcgtgggacccggcgacaccccgccggagggttacgtccaggacccggacgtgctc
gacacctggttctcgtcggccctgtggccgttctccaccatgggctggcccgacgccacg
gacgacctggccaagttctatcccacgtccgtgctggtgaccggctacgacatcctgttc
ttctgggtggcgcgcatgatgatgttcggcacctacgtggcgcgcgaggacgcgggcgac
ggcggtgtgctgggcccgcgcggccaggtgccgttccaggatgtgttcctgcacggcctg
gtgcgcgacgagcacggccgcaagatgtcgaagtcccgcggcaacggcatcgacccgctc
gactgggtcgagcgcttcggcgcggacgcgctgcggttcacgctggcgcgcggggccaat
ccgggctcggacctgtcggtgggcgagggcaacgcgcagtcgtcgcgcaacttcgcgaac
aagcttttcaacgccacccgcttcgccctgatgaacggcgcgaagccgggcgggctgccg
ccgcgcgaccggctcacggccgccgaccggtggatcctcgaccggctggaacaggtgcgc
gcgggcgtggacgaatcctacgagcgttacgagttcggcaaggccgccgaggcgctctac
cacttcgcctgggacgaggtgtgcgactggtacctggaactggccaaggtgcagttcgcc
ggtgagggcgacggaagcggcgagaccgggttccgggcggaggcgacccgcaccgtcctc
ggcaccgtgctcgacgcgctgctgcgcatgctgcatcccatgatccccttcgtcaccgag
accctgtggaaggtgctcaccggtggtgagtcgctggtcatcgcctcgtggcccgtcgcg
gacgcggacacggcggcagatcccgaagcggcacgtcaggtggccgatacgcagaagctc
atcaccgagatccggcgattccgctccgaccagggcgtcaagcccagccagcgggtgccg
gcccggctcggggcgctggaggacgccgggctcgtcccgctcgagggcgcggtgcggtcg
ctcgctcgcgtcaccgcggcggaggcgggtttcacggccaccgcgtcgatcgaggtgcgt
ctgagcgccgcgaccgtcgtcgtcgacctggacacctccagcacggtggacctggaggcc
gagaagcgccggctcaccaaggacctcgccgccgcgcacaaggaactcgccggcaccacc
gcgaagctcggaaacgaggcattcctcggcaaggctcccgagcaggtcgtggagaagatc
cgcggccgccgcgacgtcgccgcggccgatgtggacaggctcgaggcgcggctggcggag
ctggggcagccggcagagggaggcgcgcggtga

DBGET integrated database retrieval system