KEGG   Treponema pallidum subsp. pallidum Nichols: TP_0673Help
Entry
TP_0673           CDS       T00016                                 

Definition
(GenBank) glutamyl-tRNA synthetase (gltX)
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
tpa00970  Aminoacyl-tRNA biosynthesis
tpa01100  Metabolic pathways
tpa01110  Biosynthesis of secondary metabolites
tpa01120  Microbial metabolism in diverse environments
Module
tpa_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TP_0673
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TP_0673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tpa01007]
    TP_0673
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tpa03016]
    TP_0673
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:tpa02048]
    TP_0673
Enzymes [BR:tpa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     TP_0673
Amino acid related enzymes [BR:tpa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   TP_0673
Transfer RNA biogenesis [BR:tpa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TP_0673
 Prokaryotic Type
   Other AARSs
    TP_0673
Prokaryotic defense system [BR:tpa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    TP_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AAC26571
UniProt: O83679
Position
complement(738054..739667)
Genome map
AA seq 537 aa AA seqDB search
MEVRVRYAPSPTGLQHIGGIRTALFNFLFARAHAGVFVLRVEDTDRSRCTAAFEQNLYDT
LRWLGVSWDEGGGCPETAVKQGARGDGRSVAHAGGAYGPYTQSARTDLYRAQVARLVETG
QAYYCFCDASRLERVRKIRTLNRMPPGYDRHCRELLPEEVRECLASGVPHVIRFKVPLEG
STHFRDALLGDIEWQNEEINPDPILLKSDGFPTYHLANVVDDHAMRITHVLRAQEWVPST
PLHLLLYRAFGWQPPLFCHLPMVMGADGHKLSKRHGATSCDEFRNAGYLPEALLNYVAML
GCSYGEGQDLFTREQLCAHFSLSRLNKSPAVFDYKKLAWFNGQYIRAKSDEQLCALVWPF
IANAGVCGHIPADVEAGAVRTRRFADEAPCAPTEAQRSMLMRVIPLIKERLRFLTDAPEL
VRCFFQEPSLPEQGVFVPKRLDVAQVRAVLVRARGLVHEIVSASEPDVEVLLRAEAEKFG
IKLGDFLMPIRVALTGATVSAPLVGTIRILGASRSCARIEHVIRERFSDDSQGVGGG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtgagagttcggtacgcaccgtctccgacggggctccagcacatcgggggtatt
agaactgctctcttcaacttcttgttcgcgcgagcgcatgcaggcgtatttgtcctccgt
gtcgaggatactgaccgcagtcgctgcactgcagcgtttgagcagaacctttacgatacg
ctccgttggcttggggtctcctgggatgaggggggagggtgcccagaaacagcggtgaag
cagggcgcgcggggggatggccgctctgttgctcacgctggtggggcctatggcccttac
acgcagtctgcacggacagatctctaccgcgcgcaggtggcgcggctcgttgagacaggg
caggcgtattattgtttttgcgatgcgtcgcggctcgagcgcgttcgtaagatccgtacg
ctcaacaggatgccccccggttatgaccggcattgccgcgagctcctgcctgaagaagtt
cgggaatgtctcgcatccggggttccacatgtgatccgctttaaggtccccttggaaggg
agtactcatttccgcgatgcgctgctcggtgatatcgagtggcaaaatgaggagatcaat
ccagacccgattttactgaaaagcgacgggttccccacttaccatttggctaatgtggta
gatgaccatgctatgcgtattacgcatgttttgcgcgctcaggagtgggttccctccacc
ccgttacaccttctgttgtaccgtgcttttggctggcagcccccgctcttctgtcatctt
ccgatggttatgggggcagatgggcacaagttgtcaaagcggcatggagctactagctgt
gatgagttccgcaacgcggggtatttgcctgaagcgttgctcaactatgttgcaatgctc
ggttgctcgtacggagaaggtcaggatctgttcacgcgagagcagctgtgtgcgcacttt
tctctgtcgcgtttaaataagtcaccggctgtttttgactataaaaagcttgcgtggttt
aacggtcaatatatccgtgcaaaaagtgacgagcagctgtgtgcgctcgtgtggcctttc
attgcaaacgccggtgtgtgtggccacattccggcagatgtggaagcaggagctgtgcgc
acacgacgttttgcagacgaggcgccgtgtgcgcctacagaagcgcagcgttccatgctc
atgcgagttatcccgctgattaaggagcggttgcggtttctaaccgatgcgccggagttg
gtgcgttgtttttttcaagaaccgtctctccctgaacaaggggtgtttgtgccgaagcgc
ttggatgttgcgcaggtgcgcgcggtactggtgcgcgccaggggcctggtgcacgaaata
gtgagtgccagtgaaccggatgttgaggtgctcttgcgtgctgaggcagaaaagtttgga
ataaaacttggtgattttctcatgcccattcgcgttgcgctcaccggtgctaccgtgagt
gcccctctggtaggaactatccgcatcctgggggcgtcacgatcctgtgcgcgtattgaa
cacgtcattcgtgaacgcttttcggatgacagtcaaggagtgggaggaggctga

DBGET integrated database retrieval system