KEGG   Thermococcus pacificus: A3L08_00080Help
Entry
A3L08_00080       CDS       T05192                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tpaf  Thermococcus pacificus
Pathway
tpaf00630  Glyoxylate and dicarboxylate metabolism
tpaf01100  Metabolic pathways
tpaf01110  Biosynthesis of secondary metabolites
tpaf01120  Microbial metabolism in diverse environments
tpaf01130  Biosynthesis of antibiotics
tpaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L08_00080
Enzymes [BR:tpaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L08_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ASJ05841
UniProt: A0A218P4Z0
Position
complement(10458..11792)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYP
WYEHERWADMSAKAYHFTDMGDGSWIVRIAYPEHIFEEGNMPGFLASVAGNVFGMKRVEW
LRLEDIYLPERFLRNYPGPNFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYKLALDL
YTGGADYLKDDENLTSPWYNRFEERVKVVTKAMEKAENETGEKKTWFANITSPILEMEQR
LEILADYGVPHAMVDVVVLGWGVLDYIRELAEDYGIALHAHRAMHTAFARYKYHGISMFV
LAKLYRVIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVYHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIDALGKDIVLQLGGGTMGHPDGPAAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagttcgacaagatatacgactactacgtggacaagggctacgagccgaac
aagaagagggacataatagccgttttccgcgttactccggcggagggatacacgatcgag
caggcagccggtgcagtcgctgccgagagctcgaccggaacctggacgaccctttatccc
tggtacgagcatgagagatgggccgacatgtcggcaaaagcttaccacttcacagacatg
ggtgacggtagctggattgtcaggatcgcttacccggagcacatcttcgaggagggcaac
atgcctggctttttagccagcgtcgctggcaacgtcttcggaatgaagcgcgtcgagtgg
ctccgccttgaggatatctaccttccggagaggttcctcaggaactacccgggacccaac
ttcggcattgagggtgtcaggaagaagctcgaaatctatgacaggccgctctacggtgtc
gtccccaagccgaaggtaggttactccccggaagagctctacaagcttgccctcgacctc
tacacaggtggagccgactacctcaaggacgacgagaacctcaccagcccgtggtacaac
cgcttcgaggagcgcgttaaggtcgtcaccaaggccatggaaaaggccgaaaatgagacg
ggagaaaagaagacctggttcgccaacattacctcgccaatactcgagatggagcagagg
cttgagatactcgccgactacggcgttccccacgcgatggttgacgtcgtcgtcctcggc
tggggcgtcctcgactacatccgcgagcttgccgaggactacggcatagctttgcacgcc
cacagggcaatgcacaccgccttcgcccgctacaagtatcacggcatctcgatgttcgtc
ctggccaaactctaccgcgtcatcggcgttgaccagctccacattggtacagccggggcc
ggtaagatggagggcgagaagtgggaggtcatccagtacaagaggataatcaccgaggac
cactacgttccggacgaaaacgatgtctatcaccttgagcagaaattctatcacattaag
cccgtcttcccgaccagctccggcggacttcaccccggcaacatccagcccgtcatagac
gccctcggaaaggacatagtcctccagctcggcggtggaacgatgggacacccggacggg
ccagctgcgggagccagggctgtcaggcaggcaatagacgctatcatgcagggaatcccg
ctcgacgagtacgccaagacccacaaggagctcgccagggccctggagaagtggggccac
gtcaccccggtttga

DBGET integrated database retrieval system