KEGG   Treponema pallidum subsp. pallidum Sea 81-4: TPSea814_000056Help
Entry
TPSea814_000056   CDS       T03185                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tpas  Treponema pallidum subsp. pallidum Sea 81-4
Pathway
tpas00620  Pyruvate metabolism
tpas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPSea814_000056
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tpas02000]
    TPSea814_000056
Enzymes [BR:tpas01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     TPSea814_000056
Transporters [BR:tpas02000]
 Other transporters
  Primary active transporters [TC:3]
   TPSea814_000056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 ADH_zinc_N His_biosynth HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AHN66760
Position
64366..66147
Genome map
AA seq 593 aa AA seqDB search
MSTPVRISEMVLRDAHQSLHATRMTTEDMLPICDKLDRVGYWSLEAWGGATYDACIRFLN
EDPWERLRALKSRLPKTPIMMLLRGQNLLGYRHYADDVVDAFVEAAARNGVDVFRIFDAL
NDPRNLSQAARAAKKTGKHVQMAISYATTPYHTAEKYVELAKEYARFGADSICIKDMSGL
LTPYGAYDLVSAIKKSVDLPVELHTHATTGMSVATLVKAAEAGVDVIDTAIASMSMGTSH
SPTETLVEILRHTGRDSGLDINLLLEIAAYFRQVRKCYAQFESSFLGADTRILVSQVPGG
MLSNLENQLREQGALDKMDQVLKEIPLVQKDCGYIPLVTPTSQIVGTQSVLNVLFGRYHR
LTAETRRLLTGQYGRTPASCDAGLVERALKEEKLSQSLVCRPADALPHELDRMRSEARAA
GAQDTIEDVLTYAMFPKIAPTFFASRAQGPISFRGKGQGQKQKGESAGSVASYVATVNGT
AYTVVQEGAVLRVNGTPYTVRVEAGPSVASGTSQGTVTTAKVGACTTLPAPVAGSVVKHT
VQDGATVNSGETVLMVESMKMELEVKATAAGTIHFLIAPGAHVSAGQVLAEIR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccccggttcgcattagcgaaatggtcctacgtgatgcgcatcagtctttgcac
gctacgcgcatgactaccgaagacatgctccctatttgtgacaagctagatcgcgttggg
tattggagtttggaggcgtggggaggcgccacgtacgacgcctgcattcgctttctaaat
gaggatccctgggagcgtttgcgtgctctcaaatctcggttacctaagacccctattatg
atgcttttgcgtgggcaaaacttgctaggctaccggcattacgcggatgacgttgtagat
gcgttcgtagaggccgctgcacgcaacggcgttgatgtgttccgcatcttcgatgcactt
aatgacccacgtaacctcagtcaggctgcgcgtgctgcaaagaaaacaggcaagcatgtg
cagatggctatctcttacgctaccacaccctatcataccgcagagaagtacgtagagtta
gcaaaggagtatgcgcgcttcggtgcggattctatttgcattaaggatatgtcggggttg
ctgaccccgtacggggcgtacgatctggtttctgccattaaaaagagtgtcgatttgccc
gttgagttgcacacccacgccactactggtatgtctgttgcaaccctggtgaaggcggca
gaagcaggtgttgatgtaattgacactgccattgcttctatgtccatgggtacttcccac
agccctacagagactttagtggaaatcctacggcacacgggccgtgactcagggctcgac
ataaatctcctgctagaaatagcagcctacttccgtcaggtacggaagtgctatgcccag
tttgagtctagttttctgggtgcagacacgcgtatcctcgtgtcccaggtgcctgggggt
atgctttccaatttagaaaaccagttgcgtgagcagggagccctggataagatggaccag
gttcttaaggaaattcccctggtacagaaggactgcggttatatcccgcttgtgactcct
acgagtcagattgtaggtacgcagtcagtattgaacgtgctgtttggccggtaccaccgg
cttactgctgagacaaggcgtctgctcacgggtcagtatggccggactcccgcctcctgt
gatgcaggtttggtggagcgggccttgaaggaagaaaagttatcgcagtcgcttgtctgc
cgcccagcggatgccttgcctcatgagcttgatcgcatgaggtctgaggcgcgcgccgca
ggcgcacaggataccattgaggatgtgctcacgtatgctatgtttcccaagatcgctccc
acattctttgcttcccgtgcgcaagggcctatttcgttcagaggaaaggggcaggggcaa
aaacagaagggtgagagtgcagggtcggtagcttcttatgtggctaccgtaaatggtact
gcgtacacagttgtgcaggaaggcgctgttctccgggtaaatggtactccctacaccgtt
agggttgaggcaggcccgtccgttgcttcgggtacgtcgcagggtaccgtgactacggca
aaggttggggcgtgtactacgctacccgcgccggtcgcaggtagcgtagttaaacacacc
gtgcaagatggagctacggtaaattcgggggagacggtgctcatggtggagtccatgaag
atggaacttgaagtgaaggccaccgctgctggtactatccatttcctaatagcgcctggc
gcgcatgtcagtgcggggcaagtcttagcagagattcgctag

DBGET integrated database retrieval system