KEGG   Treponema pallidum Fribourg-Blanc: TPFB_0386Help
Entry
TPFB_0386         CDS       T02651                                 

Gene name
murF
Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
tpb  Treponema pallidum Fribourg-Blanc
Pathway
tpb00300  Lysine biosynthesis
tpb00550  Peptidoglycan biosynthesis
tpb01100  Metabolic pathways
tpb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    TPFB_0386 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TPFB_0386 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TPFB_0386 (murF)
Enzymes [BR:tpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     TPFB_0386 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AGK84032
Position
411823..413202
Genome map
AA seq 459 aa AA seqDB search
MLLSFDEVCAAVQGARVCDARGARGFDGVSFDSRAVVPRDLFIPLRGAHVDGHTFVEEAL
QKGAVATLIDQRYPHAGEYVAWCTRFGAACIAVHDTLRALQDLASFYCKKFPALIRIGIT
GSSGKTTVKEMARAVFSERYRVVATPGNLNSEIGLPQSLFFVRAEHEVGIFELGMNRRGE
MRTLAQILVPHYAIITNVGCAHVGILGTQQAIAEEKKEIFSQFTEHSVGFVPDDAYRVFL
SNIPYGRVVVYDQGGRGLATEVIDEGLRGSRVLYQGRWIRVPLPGVHNAKNALAVIALAA
QVGLPAEEIQRGMERVKPPFGRSHVVCASLTFLLDCYNANPDSMAAALHLCAHISAVSKV
YVLGDMGELGVTAAEAHYRVCVLAAASDARAVYVFGPEFCRAVRKVSWGRKRVYAFALEE
LSALQETLDAQLRRGDFVLVKGSRSVALERLEPLLRKER
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgagttttgatgaggtatgtgcggcagtgcaaggggctcgcgtgtgcgatgca
cgaggggcgcgcggttttgacggggtttcctttgacagtcgtgcggttgtgccgcgtgat
ttgtttattccgctccgtggtgcgcacgtagatggacatacgtttgttgaagaagcgctg
cagaagggcgcagttgcaacgcttatagatcaaaggtacccccatgctggggaatatgtt
gcttggtgcactcgctttggagctgcctgtattgcggtgcacgacacgctcagggcgctg
caagatcttgcctccttttactgcaaaaagtttcctgcgcttattaggattggcattacc
ggatcaagcggaaagacaaccgtaaaagaaatggctcgcgcggtgttcagtgaacggtat
cgggtggttgcgacgccaggaaatttaaattcagagataggtttaccgcagtcgctgttt
tttgtgcgtgcagaacatgaggtaggaatctttgagctggggatgaatcgtcggggggag
atgcgtacgctcgctcagatacttgttcctcattacgcgatcattaccaacgtaggttgt
gcgcacgtaggcattctgggcacgcagcaggcaattgcggaagagaaaaaagagattttt
tctcaatttactgaacacagcgtgggttttgtccccgacgatgcataccgtgtattcctg
tctaatatcccgtacggtagggttgtagtttacgatcagggggggcgtggtctagcaact
gaggtgatagatgagggtttacgtggttctcgcgtgttatatcaaggacgatggattcgc
gtgccactacctggggtgcataacgcaaagaatgcgcttgcagtgattgcgcttgccgca
caggtaggacttcctgctgaggaaattcagcgggggatggagcgggtaaaaccgcccttt
ggccgctctcatgtggtgtgtgcgtcgctgacctttttgctcgattgttacaatgcgaat
cctgattcaatggctgcggcgcttcatttgtgtgcgcatatttctgcagtatcaaaagta
tatgtgctcggtgacatgggagagctaggagttaccgctgccgaagctcactatcgggtg
tgtgttttggcagctgcttctgacgcgcgtgcagtgtatgtgtttggtcccgaattttgt
cgtgcggtaagaaaagtttcctgggggaggaagcgcgtgtacgcctttgcactagaggaa
ctgtctgcgctgcaagaaacgttagacgcgcaattacggcggggtgattttgttctggtg
aaaggttcacgcagtgttgcgctcgagcggcttgaacctcttttgaggaaagagcgatga

DBGET integrated database retrieval system