KEGG   Treponema pallidum Fribourg-Blanc: TPFB_0478Help
Entry
TPFB_0478         CDS       T02651                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tpb  Treponema pallidum Fribourg-Blanc
Pathway
tpb00030  Pentose phosphate pathway
tpb00480  Glutathione metabolism
tpb01100  Metabolic pathways
tpb01110  Biosynthesis of secondary metabolites
tpb01120  Microbial metabolism in diverse environments
tpb01130  Biosynthesis of antibiotics
tpb01200  Carbon metabolism
Module
tpb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TPFB_0478 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TPFB_0478 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tpb04147]
    TPFB_0478 (zwf)
Enzymes [BR:tpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TPFB_0478 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TPFB_0478 (zwf)
Exosome [BR:tpb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TPFB_0478 (zwf)
  Exosomal proteins of colorectal cancer cells
   TPFB_0478 (zwf)
  Exosomal proteins of bladder cancer cells
   TPFB_0478 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AGK84123
Position
complement(509559..511106)
Genome map
AA seq 515 aa AA seqDB search
MGKISGSGTVAPHILVIFGASGDLAARKLIPSLWDLFEQELLPRTFGILGAGRTALSTES
FRARLAEAVTKHAVRTPHDPARLTEFLQKIHYFSFDPTDSVAFADFATYVRTLDQSLHTE
GNFIFYLATPPSLYETIPTQLAMHHLNREQGNFRRVVIEKPFGYNLETAQHLNASLRAHF
QENQTYRIDHYLGKETVQNILVTRFANPLFEPTWNRTHIDYVEITASESLGVENRGGYYD
QSGALRDMIQNHLLLLLGIIAMEAPAVVSSSRLRDEIVKVFDCLRPMGERDVMQHTVRAQ
YVAGKIRGVAVPGYLEESGVDPRSCTETFAALKCYIDNWRWMDVPFYLRTGKRLPTGVTE
VIVHYRTLPIALFEHIERPCAREGNALVIRIQPDEGIQLKIDLKEPGAGFKTIPVSVDFQ
YSALTYSHLPSAYERLLLDCMNGDNTLYHRDDAVESAWRFIDPILAAWKSNKSPLLTYPA
GSWGPKAADDLIKGSAPRWHHPSSTLLSDDFACRL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaatcagtggcagcggcacggtcgcgccgcacatcctggttatctttggcgct
tcaggcgaccttgccgcgcggaagcttatcccctcgctttgggatctctttgagcaagag
ctcctgccccgtacattcggtatactcggcgcagggcgtacggctctgtctacagagtct
tttcgcgcacggcttgcagaggcggtcacaaagcatgcagtgcgcacaccgcacgacccg
gcgcgcctcaccgaattcctgcagaagatccactacttctcgttcgatcccaccgactct
gtcgcctttgccgactttgccacgtacgtgcgcaccctcgaccagtcgctgcacaccgag
ggcaactttatcttctatcttgccactccccctagcctgtacgaaactatccccacgcag
cttgctatgcaccacttgaaccgggaacagggtaattttcgcagggtagttattgaaaaa
ccctttggctacaacctagaaaccgcgcagcaccttaatgcgagcttgcgtgcccacttt
caggaaaaccaaacctatcgcatcgatcactatctgggtaaagaaacggtccaaaacatc
ctggtcactcgctttgccaatccccttttcgagcccacatggaaccggacccatatcgat
tacgttgaaattactgcaagcgaatcactaggtgtcgaaaaccgcggcggttactacgac
cagtccggtgcattgcgcgatatgatccaaaaccacttgttactcctcttgggtattatc
gcgatggaggcgcccgccgtcgtgagttcaagtcgtctacgggatgaaatcgtaaaggtc
tttgactgcctgcgccctatgggagaacgcgacgtcatgcagcatacggtgcgtgcccaa
tacgtcgccggcaagatacgcggtgtagccgtccccggctaccttgaggagtcaggcgtt
gaccctcgctcgtgcactgaaacctttgccgcactcaagtgctacatcgacaattggcgg
tggatggacgttcccttctacctgcggacgggtaagcgtttgcccacgggcgtcactgag
gtgatcgtccattaccgaacgctccccatcgcgcttttcgagcacatcgaacgcccgtgc
gcacgcgagggcaacgcgcttgtcattcgcattcaacccgacgaaggaattcagcttaaa
atcgacctcaaagagcccggcgcggggttcaagactattcccgtcagtgttgattttcag
tattcggctcttacctattcgcacttacccagcgcgtatgagcggctattgcttgactgc
atgaatggagacaacacgctctaccatcgagatgacgcggtggagtctgcatggcgcttc
atagatcctattcttgccgcatggaaatcaaacaagagtcctctacttacgtaccctgca
ggaagctggggtccgaaggctgcagacgacctgatcaaagggagtgctccacggtggcat
cacccctcttctacgctgctcagcgatgattttgcctgccgactctag

DBGET integrated database retrieval system