KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0588
Entry
Teth39_0588       CDS       T00649                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
tpd  Thermoanaerobacter pseudethanolicus
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tpd03000]
    Teth39_0588
Transcription factors [BR:tpd03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Teth39_0588
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 HTH_38 HTH_7 HTH_Tnp_ISL3 HTH_23 Trp_repressor TetR_N HTH_24 TnsD
Other DBs
NCBI-ProteinID: ABY94252
UniProt: B0K7A5
Position
627610..628602
AA seq 330 aa
MANIREVAKRAGVSVATVSRVLNDSDSVSEETRERVLKAIKELNYHPNLLGRNLRRSETK
MILALMPNVSNPFYARVVKGIEDVAHKNGYNVMLCNTDSDINREKVYLEILKNRLADGVI
FMAPVMGKEELTLIGQNYPVVQCCEYIEGAGVSYVSIDNFSAAYKAVKHLIGLGHKRIGM
ISCENNFVSTKQREAGYKKALEDSRIEFDEKLIKYGDYSFKSGVRAAKQLLAMEERPTAI
FAISDIMAIGAIRAIKEERLKVPEDIAVVGFDDISFASMYDPMLTTISQPKYDLGCVAME
LLIKHMCGKLEEPQRIFLEHELIIRESTVK
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctaatattagagaagttgctaaaagagcaggagtctctgttgcaacagtatcaaga
gttttaaatgacagtgactcggtgtctgaagaaacaagggaaagagtattaaaagcgata
aaagaattaaattatcatccaaatctccttggaagaaatttaagacgttctgaaacgaaa
atgatattggctttgatgcctaatgtctcaaatcctttttatgcaagggttgtaaaagga
atagaagatgtagcacataaaaatggttataatgtaatgctttgcaatactgattctgat
attaacagagaaaaagtatatcttgaaattttaaaaaacagattagcggatggcgttatt
tttatggcgcctgtgatgggaaaagaagaattgacattgataggccaaaattatcctgtc
gttcagtgttgtgaatacatagaaggagctggcgtttcatatgtatctatagacaacttt
tctgcagcttacaaagcggtgaagcatttgataggattgggacataaaagaataggaatg
ataagctgtgaaaataactttgtatctacaaagcagagggaagcgggttataaaaaagct
cttgaagattcaaggatagaatttgacgaaaagcttataaaatacggagattacagcttt
aaaagcggagtaagagcagcgaaacagcttttggcgatggaagaaaggcctactgctata
tttgcaatctctgacatcatggctattggagctataagagcgataaaggaagaaaggctt
aaagtccctgaggatatagcggttgtaggctttgatgatataagctttgcttctatgtat
gaccctatgcttacaactatttcacagccaaagtacgatttaggatgtgttgctatggaa
ctactgataaaacacatgtgtggcaaattagaagaaccacagaggatttttttagagcat
gagctaataataagagagtcgacagtaaaataa

DBGET integrated database retrieval system