KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0379Help
Entry
Teth39_0379       CDS       T00649                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Teth39_0379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tpd03011]
    Teth39_0379
Ribosome [BR:tpd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Teth39_0379
  Bacteria
    Teth39_0379
  Archaea
    Teth39_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABY94048
UniProt: B0KCK5
Position
422033..422368
Genome map
AA seq 111 aa AA seqDB search
MEARAIARYVRISPRKVRLVLNLIRGKHVDEALTILRFTPKRASGIVAKVLKSAIANAEN
NHGMNRDNLYVAKAVADEGPTMKRVFPRAMGRADIMRKRTSHITIVVKEKE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcaagggcaatcgccagatatgtaagaatttcgcctcgaaaggtaagattagtt
cttaacctgattcgtggcaagcatgtggatgaagccttaactattttaaggtttactccc
aaaagagcctcaggtatagttgccaaggttcttaaatcagccattgctaatgccgaaaat
aaccatggaatgaatagagataatctgtatgtggcaaaggctgtggcagatgaaggccct
acaatgaagagagttttcccaagagcgatgggaagagcagatattatgaggaagagaacc
agtcatataacgatagttgtgaaggaaaaagaataa

DBGET integrated database retrieval system