KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0514Help
Entry
Teth39_0514       CDS       T00649                                 

Definition
(GenBank) Histidine--tRNA ligase
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00340  Histidine metabolism
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01230  Biosynthesis of amino acids
Module
tpd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Teth39_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ABY94179
UniProt: B0K732
Position
546767..547909
Genome map
AA seq 380 aa AA seqDB search
MIYLPDGVQDFLPEEYKFKRKIEEKFREVFIKFGYQEIMPPTFEYSDNFSVLFDENNLYR
FFDKKGNILALRPDVTTQIARIVSTKLKGSFPLKLCYVANVYRYDDPQVGKMREFTQAGI
ELIGTNHEESDAEIIAVAIEALKSVGIKDFKVDVGQVEFFKRVVEDLELQNEEINLLREF
LQQKNQSAIEEFINDKGIRGKKAKFLSELPLLFGGEEVLKRAKELYDTPKLGETIDYLER
VYRILKDFGMEEYISFDLGMVQNLNYYTGIIFRCFVKGIGYAICTGGRYDGLLGIFGEHI
PATGFAISVERSMLALQKQKKDIIDKSWRVLIKYKENLRSNAYKKATLLRGEGKIVEMYS
YEKAKHVDENSFDEIIDMEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatatatttgcctgatggtgtacaagattttttaccggaagaatataagtttaagcgc
aaaatagaagaaaagtttagagaggtttttataaaatttggctatcaagagataatgcct
cctacttttgaatatagcgataatttttctgttttgtttgatgaaaacaatttgtacaga
ttttttgataaaaagggaaatatattagctttaaggccagatgtgactactcaaatagcg
agaattgtctctacaaagttaaaaggtagtttcccacttaagttatgctatgtcgctaat
gtctatcgctatgatgatccccaggtaggaaaaatgagagagtttactcaggcagggatt
gaacttataggtacaaatcatgaagaatctgatgcagagataattgcagttgcgatagag
gctttaaaaagtgttggaataaaggactttaaagtggacgtgggacaggtggaatttttt
aaaagagtagtggaagatttagagttacaaaatgaagaaataaaccttttaagagagttt
ttgcaacagaaaaatcaatctgcgatagaagaattcataaatgataaaggaattaggggc
aaaaaagcaaagtttttaagtgaacttcctcttttatttggtggcgaagaagtgcttaaa
agagcaaaagagctttatgatactcctaaactaggtgaaacgatagattaccttgaaaga
gtatatagaatattaaaagattttggtatggaagagtatataagttttgacttaggaatg
gtgcaaaatcttaattattatactggtatcatattcaggtgttttgttaaagggattggt
tatgctatatgtaccggaggaaggtatgatggtcttttagggatttttggagagcacatt
ccggcgacaggttttgctataagtgtggaaaggtcaatgttagcacttcaaaaacagaaa
aaagatattattgataaatcctggagagttttaataaaatacaaggaaaacttaagaagt
aatgcttacaagaaagccactttgttaagaggtgagggaaaaattgtagagatgtatagc
tatgaaaaagcgaagcatgttgatgaaaatagctttgacgaaattatagatatggaggaa
taa

DBGET integrated database retrieval system