KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0570Help
Entry
Teth39_0570       CDS       T00649                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Teth39_0570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tpd03400]
    Teth39_0570
DNA repair and recombination proteins [BR:tpd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Teth39_0570
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Teth39_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_21 AAA_29 AAA_16 AAA_23 RsgA_GTPase AAA_22 AAA_18 AAA_14 DnaJ_CXXCXGXG RNA_helicase ATPase_2 AAA_25 APS_kinase AAA_33 cobW NACHT MMR_HSR1 BCA_ABC_TP_C Viral_helicase1 DUF2075 PRK NB-ARC T2SSE NTPase_1 MeaB AAA_24
Motif
Other DBs
NCBI-ProteinID: ABY94234
UniProt: B0K787
Position
606337..609120
Genome map
AA seq 927 aa AA seqDB search
MAKDKIVIKGARVHNLKNVDLEIPRDKLTVITGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDYIEGLSPAISIDQKTTNKNPRSTVGTITEIYDYLRLLYARAGIP
HCPVCGKEISMQTIDQMVDRVKELPEGTRIQVLAPVIRGRKGEYAKLLNDIKKSGYVRVK
IDGVMYDVNEEIKLDKNKKHTIEVVVDRVIIKPGIDMRLTDSIETALKLADGIVSIDVID
GESFTLSEKYACTECNISIEELSPRMFSFNSPYGVCPVCTGLGEFMKVDPELLIQDPKKS
LANGLLPGIVASQDSYAYYNILRLIEHFGYTENTPYEKFSEDLKNVLLYGKDTKGKSYGF
EGIVNNLERRYNNTSSDFIKEEIEKYMRPVTCPACHGARLKPEALAVTVGGLSIKEMTDL
SVGELIKFIEELKLTEKQEIIAKPILKEIKARLNFLVDVGLDYLTLSRPAATLSGGEAQR
IRLASQIGSGLVGVTYILDEPSIGLHQRDNERLINSLKKLRDQGNTLIVVEHDEDTIYAA
DYIVDVGPGAGEHGGEIVIAGTIEDVLKCEKSITGQYLSGKIKIEVPKQRRKPNGKALIV
KGAKENNLKNIDVVFPLGVFICVTGVSGSGKSTLINEILYKALAQKIYKSKDKPGMHDAI
EGIDNIDKVINIDQSPIGRTPRSNPATYTGVFDYIREVFANTPEAKMRGYKPGRFSFNVK
GGRCEACGGDGIIKIEMNFLPDVYVPCEVCKGQRYNRETLEVKYKGKNISDVLNMTVEEA
LEFFENIPRIKNKLMTLYDVGLGYIKLGQPSTQLSGGEAQRVKLATELSKRPTGKTLYIL
DEPTTGLHFADVHRLLEVLNRLTDAGNTVIVIEHNLDIIKSADYIIDLGPEGGDKGGRVI
ATGTPEEVAANENSYTGHFLKKVLSQK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagacaaaattgtaattaaaggggcaagagttcataatttaaaaaatgtagat
ttggagattccacgagataaattaactgtgataacgggtttatcaggttctggtaagtct
tctcttgcctttgataccatttatgctgaaggtcagagaagatatgtggagtcgttgtca
gcttatgcaaggcaatttttaggacaaatggacaaaccagacgttgattatatagaaggt
ctttcaccggcaatatctatagaccaaaagaccacaaataaaaaccctcgttctacggta
ggaacgataactgagatttacgactatctaagacttttatatgcaagggctgggattccc
cattgtcctgtttgtggaaaagagattagcatgcaaactatagatcagatggtagacaga
gtcaaagaattgccagaaggtacaaggatacaggtactggctcctgttattagaggaaga
aaaggggaatatgctaagcttttaaatgacataaaaaagagcggatatgtcagagtgaaa
attgatggagtcatgtacgatgtaaatgaggagattaaacttgacaaaaataaaaagcat
actattgaagttgtggtagacagggttattataaaaccgggaatagacatgaggttgaca
gactctatagaaacagctttaaaattagcagatgggatagtttctattgatgtaatagac
ggagaaagctttacactctctgaaaaatacgcttgtacagagtgcaacataagtattgaa
gaactttccccgagaatgttttccttcaatagcccttatggggtttgccctgtttgcact
ggattgggagaatttatgaaggtagatccagagcttttaatacaagaccctaaaaaatca
ttagcaaatgggttgttgccggggattgttgcttcacaggatagttatgcttattacaac
attttaagattaattgaacattttggatatacagagaatactccttatgaaaagtttagt
gaagatttaaagaatgtactgctttatggcaaagatacaaaaggtaagtcctatggattt
gaaggtatagtaaacaatcttgaaagaaggtacaacaatacttcttcagattttataaaa
gaagagatagagaaatatatgagaccggttacttgtcctgcatgccatggggctagatta
aagccagaagcgctagctgtgactgttggtggactttccataaaagaaatgacagacctt
tctgttggcgagcttataaaatttattgaggaactcaaattaacagaaaaacaagagatt
attgcaaagccaattttaaaagaaataaaggcaaggcttaattttcttgtggatgtagga
ctggattatttgactctttcaagacctgcagctactttatcaggtggagaagcacaaagg
ataagattggcaagccagataggctctgggcttgtaggagtcacatacatcctggacgag
ccgagcattggacttcatcaaagagataatgaaaggcttataaattccttgaaaaaatta
agagaccaaggcaatactcttatagtagtagagcacgatgaggatacaatatatgcggca
gactacattgtggatgtaggaccaggcgcaggtgagcatggaggagaaattgtaattgcg
ggtacgatagaagatgtgttaaaatgtgaaaaatcaattacaggccagtatttaagtggt
aaaataaagatagaagtgccaaaacagaggagaaaacctaatggaaaagctttaatagtg
aaaggagctaaggaaaacaatttaaagaatatagatgtggttttccccctcggagtattt
atatgtgttacaggggtttctggctcaggcaaaagcacccttataaatgagatactgtac
aaagcattggcacagaagatttataagtccaaagataaaccaggtatgcacgatgcaata
gagggtatcgataatatagataaagtaataaatattgaccagtctcctataggcaggact
cctcgctcaaatcctgctacctatacaggagttttcgactatataagagaggtttttgca
aatactccagaagctaaaatgagaggctataaaccaggaagatttagttttaatgttaaa
ggtggaaggtgtgaagcctgtggtggagatggtataattaaaattgagatgaactttttg
ccggatgtgtatgtcccttgtgaagtctgcaaagggcaaaggtataatagggaaacattg
gaagtaaaatataaagggaaaaatatttcggatgtacttaatatgacggtagaagaggcg
ttagaattttttgaaaatatacccaggataaaaaataaattgatgactttatatgatgtg
ggtttaggatatattaagctagggcaaccttctactcagctttcaggaggagaagcacaa
agagtaaaattagctactgaactttctaaaaggcctacaggtaaaacactatatattttg
gatgagcctacaactggattacattttgcagatgtgcataggcttcttgaagttttaaat
agattaactgatgcgggcaatactgttattgtaattgaacacaacttagatatcataaaa
agtgcagactatatcattgacttaggaccagaaggtggagacaagggtggaagggtaata
gctacagggacacctgaagaagttgctgctaatgagaattcttatacaggccattttttg
aaaaaagtcctttctcaaaaatga

DBGET integrated database retrieval system