KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1043
Entry
Teth39_1043       CDS       T00649                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00472  D-Arginine and D-ornithine metabolism
tpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Teth39_1043
Enzymes [BR:tpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Teth39_1043
SSDB
Motif
Pfam: OAM_alpha DUF2067 Lys-AminoMut_A RTC
Other DBs
NCBI-ProteinID: ABY94698
UniProt: B0K985
Position
1106631..1106945
AA seq 104 aa
MKRVDDFETRSKHLQHMTDEELDAYFWELAEKIVDPLIESAYYHTSPSIERSVLLRMGFS
GIEAKEIVNRIEERGLLPKGAGNIVLKVAERLKKRLPCCWKSHS
NT seq 315 nt   +upstreamnt  +downstreamnt
gtgaaaagagtagacgattttgaaacgaggagtaaacatcttcaacacatgacagatgaa
gaattagacgcatatttctgggaattggcagaaaaaattgtagaccccttgatagagtcg
gcatattatcacacatctccatctattgagcgttctgtgcttttacgaatgggtttttct
ggtattgaggcaaaggagattgtaaacagaattgaggaaagagggcttttgccaaaagga
gcaggaaatattgtgttaaaagttgcagaaagactcaaaaaaagattaccttgctgctgg
aaaagccatagctaa

DBGET integrated database retrieval system