KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1082Help
Entry
Teth39_1082       CDS       T00649                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00330  Arginine and proline metabolism
tpd00332  Carbapenem biosynthesis
tpd01100  Metabolic pathways
tpd01130  Biosynthesis of antibiotics
tpd01230  Biosynthesis of amino acids
Module
tpd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Teth39_1082
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Teth39_1082
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Teth39_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABY94737
UniProt: B0K9C4
Position
1140405..1141523
Genome map
AA seq 372 aa AA seqDB search
MRIVVKVGTSTLTYENGKLNLEIMEKLVRQIANLLNRGEEVVLVTSGAIGAGMGKLNLKE
KPKTIPEKQSLAAIGQGLLIEIYEKFFNEYGKITAQVLLTKEDFSDRRRYLNVSYTLSNL
LKWGVVPIINENDTVTVDEIKIGDNDTLAALLASLVEADILIILTDIDGLYDKDPRIYKE
AKIIEVVEEFSDELFKIAGSAGTKRGTGGMYTKIQAAKICWNSGVKMIIANGKIDNVLNQ
IANGEKIGTTFLPMKKPISSRKVWIAFNAKVSGRLFIDEGAAKAIIKHGKSLLPSGVVKT
EGDYDVGDCVAVVDHQEKEIARGLINYSSEEVEKIKGCKTHEIEKILGYKYYDEVIHRDN
LVILERGEKFGS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgtagtaaaagttggtacaagcactttgacatatgaaaatggtaaattgaat
ttagaaataatggagaagttagtaaggcaaattgctaatttattaaacagaggagaggaa
gtagtattagtaacttctggggcaattggggcgggaatgggaaaattaaatttaaaggaa
aaacctaaaaccatcccagaaaagcaatccttagcggctatagggcaagggcttttaatt
gaaatttatgaaaagttttttaatgaatatggcaaaattactgcgcaagttcttttgact
aaggaagattttagcgatagaagaagatatttaaatgtcagttataccttgtcaaacctg
ctcaaatggggtgttgtgccaataataaatgaaaatgatacagtaactgttgatgaaatt
aaaattggagacaatgacactttagcggcgctgcttgctagtttagttgaggctgatatt
ttaataattttaactgacattgatgggctttatgataaagaccctcgaatttataaagag
gcaaaaattatagaagtcgtagaagagttttcagatgaattgtttaaaattgctggtagt
gctgggacaaaaagaggaactgggggaatgtatacaaagattcaggcagcaaagatatgt
tggaattcaggagttaagatgattatagcgaatgggaaaattgacaatgtattaaatcaa
atagcaaatggcgaaaaaattggcactacatttttgcctatgaaaaagccaataagtagc
agaaaagtttggattgcttttaatgcgaaagtaagcggaagactttttattgatgaagga
gcagcgaaagctattataaagcatgggaaaagtctattaccaagtggagttgtaaaaact
gaaggggattatgatgtaggagactgtgttgcagtggttgaccatcaagaaaaagagatt
gccagaggacttattaattattcttcagaagaagttgaaaagataaaaggttgtaaaact
catgagatagaaaagatattaggttataaatattacgatgaagtaatccatagggataat
cttgtaatacttgaaagaggtgagaagtttggaagttga

DBGET integrated database retrieval system