KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1145Help
Entry
Teth39_1145       CDS       T00649                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00620  Pyruvate metabolism
tpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Teth39_1145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tpd02000]
    Teth39_1145
Enzymes [BR:tpd01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Teth39_1145
Transporters [BR:tpd02000]
 Other transporters
  Primary active transporters [TC:3]
   Teth39_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ABY94800
UniProt: B0K9I7
Position
1195016..1196413
Genome map
AA seq 465 aa AA seqDB search
MSNKIKITETVLRDAHQSLLATRMSTEEMLPIAEKLDAVGYYSIEAWGGATFDACMRFLD
EDPWERLRRLKKRIKNTPLQMLLRGQNLLGYRHYPDDIVEKFVERAVANGIDIIRIFDAL
NDVRNLEVAVKATKKAGAHAQGTLVYTISPVHNIDHYIKVAKELTELGVDSICIKDMSGI
LTPYVAYELVKSLKDAVNIPIQLHSHYTSGMAAMTYLKAIEAGVDIIDTAISPLALGTSQ
PATETMVAILKGTQYDTGLDMELLSEIASYFKEVKQNHSKEIDLSMVMGVDTDVLIYQVP
GGMLSNLISQLKQQNALDKYPEVLKEIPKVREELGYPPLVTPMSQMVGTQAVLNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGDEEVIDIRPADLLKPQFEAIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAKKYQIDATLLNMEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaattaaaattacagaaactgtattaagagatgcccatcagtcactcttg
gctactcgaatgtcgacggaagaaatgctcccaattgcagaaaaattggatgcagtagga
tattattctattgaagcgtggggaggagctacctttgatgcttgtatgagatttcttgac
gaagacccttgggaaagattgagaagattaaagaagaggataaaaaatacccctcttcaa
atgcttttgagaggacaaaatctattaggatataggcattatcctgatgatatagtagaa
aaatttgttgagagggctgttgctaacggaatagatataataagaatttttgatgcttta
aatgatgtacgaaatcttgaagttgccgttaaagctactaaaaaagcgggagcccacgct
caaggtacccttgtttatactataagtcctgttcacaacattgaccattatattaaagta
gcaaaagagctgacagaattaggagtggattccatatgcataaaggatatgtcaggaata
ttaactccttatgttgcttatgagttagtaaaaagccttaaagatgcagtaaatattcct
atacagttgcacagccattatacgagtggaatggcggctatgacttatcttaaagcaata
gaggctggagtagatataatagacactgctatttcacctttggcattaggaacttctcaa
cctgctacagaaacaatggtagctattttaaaaggcactcaatatgacactggtttggat
atggagttattatcagaaattgcttcatactttaaagaagtaaaacaaaatcacagtaaa
gaaatagatttatctatggttatgggcgtagatacagatgtattaatttatcaagttcca
ggaggaatgctatcaaatttaatttcccaattaaaacaacaaaatgctttagataagtac
ccagaggttttaaaagaaattcctaaagttagagaagaattaggatacccacctcttgtt
actcctatgagtcagatggtagggactcaagctgtcttgaatgtaataactggagaaagg
tataaaatggtaccaaaagaagtaaaagattatgtgaaaggactgtatggtagaccacca
gcgccaatttcagaagaaataaagaaaaaaataataggagatgaagaggtaatagatatt
agaccagcagaccttttaaaaccgcaatttgaagcgattaaagaagaaattaaagagtat
tatgaacaagaagaagatgttttatcttatgctcttttcccacaagtagcaaagaagttt
tttgaatacagaagagcaaaaaaatatcaaatagatgcaactcttcttaatatggaatat
atgacatatccagtttaa

DBGET integrated database retrieval system