KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1431Help
Entry
Teth39_1431       CDS       T00649                                 

Definition
(GenBank) small GTP-binding protein
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tpd03009]
    Teth39_1431
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     Teth39_1431
Ribosome biogenesis [BR:tpd03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Teth39_1431
 Prokaryotic type
  GTPases
   Teth39_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 DUF1967 FeoB_N Arf GTP_EFTU RsgA_GTPase MMR_HSR1_Xtn MMR_HSR1_C PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ABY95081
UniProt: B0KAB8
Position
complement(1470400..1471671)
Genome map
AA seq 423 aa AA seqDB search
MFIDTARIYIKAGDGGNGIISFRREKYVAYGGPDGGDGGKGGDVIFIADPNLSTLLDFKY
RKKYIAQNGENGRGKNQYGKNGEDLYIKVPVGTLIINDETGEIIADLVKPNQKAIVLRGG
KGGRGNAKFATPTLKTPRFAESGEKGKEMWVRLELKLLADVGLIGFPNAGKSTLLASCTR
AKPKIANYPFTTLTPNLGVVEHKGKSFVMADIPGLIEGAHRGEGLGHDFLRHIERTKMLI
HVVDVSASEGRDPIEDFEKINEELKLYSERLLTLSQIVAANKIDIQSGKENFPAFEKEIK
KRGYEVYPISALTKVGIDKLLDKTIEILSSIPVEEIKEVPEVIVYTPPEEEETLNIEVKD
NTYYLSGTKIDKLLKRVNLQDEHSLRYFEMLLRKSGVIDALKEKGFKSGDTINVRDFEFE
YYE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgtttatagacacagcaaggatatacataaaagctggagacggtggaaatggaattata
tcttttagaagggaaaaatacgttgcttatggtgggccggacggtggcgacggaggaaaa
ggtggagatgttatatttatagcagatcctaatttgtctactttgttagattttaaatac
aggaaaaagtacattgcgcaaaatggagaaaatggtagaggtaaaaatcaatatggcaaa
aacggagaagatttgtacataaaagttcctgtaggaaccttgataattaacgatgaaaca
ggagaaattatagctgaccttgtaaaacctaatcaaaaagctattgttttacggggaggt
aagggaggaagaggaaatgctaaatttgctactcctactttgaagactcctcgtttcgct
gaaagcggtgaaaaaggcaaagaaatgtgggtacggttagagctaaaacttctcgctgat
gtaggattaataggatttcctaatgcagggaaatctactcttctagccagttgcacaaga
gcaaaacctaaaattgccaattatccttttacaacactgacacctaatttgggagttgta
gaacataaagggaaatcctttgtaatggcagatattccaggtttaattgaaggggcccac
agaggcgaaggattaggacatgattttttacggcacattgaaaggacaaaaatgttgata
cacgtggtggatgtttccgccagtgaggggcgagaccctatagaagattttgagaagata
aatgaggagctgaaactttacagtgaaagattacttactttgtctcaaattgttgcagca
aataaaattgatatacaaagcggtaaagaaaattttcctgcttttgaaaaagaaatcaaa
aaaagaggttatgaggtatatcctatatctgctttgacaaaagtgggaattgacaaactt
ttggacaagactatagaaattctttcttctattccggttgaggagataaaggaagtgcca
gaagttattgtttatacacctcctgaagaggaagaaactctcaatatagaagtaaaagat
aatacctattatcttagcggtacaaaaattgacaaacttttaaaaagagtaaatttacaa
gatgaacattctttaaggtactttgaaatgcttcttagaaagagcggggtaatagatgct
cttaaggaaaagggatttaaaagtggtgatacaataaatgtgagagattttgaatttgaa
tactatgaataa

DBGET integrated database retrieval system