KEGG   Thermoanaerobacter pseudethanolicus: Teth39_2007Help
Entry
Teth39_2007       CDS       T00649                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00260  Glycine, serine and threonine metabolism
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
tpd01130  Biosynthesis of antibiotics
tpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth39_2007
Enzymes [BR:tpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Teth39_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP OKR_DC_1 Aminotran_3 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABY95633
UniProt: B0KDB4
Position
2059443..2060480
Genome map
AA seq 345 aa AA seqDB search
MKYIDLRSDTVTLPTQEMREAMYKAEVGDDVYGEEPTVRKLEEMAAEMLGKEAAMLVTSG
TQGNQVSIMTHTHPGEEIIVEENCHIITYEVGGVGYLAGVQTKALKSNKGVLNPADVEKA
IRPKDIHYPVTSLICLENTHNRAGGTVTPIEIMKEIYEIAQKHNIPVHLDGARIFNAATY
LKVDVREIAKYADSVMFCLSKGLCAPIGSVVVGTKDFIEKARKYRKMLGGGMRQAGFIAA
AGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISGTGMTGKELS
LRLKEHGILINDGNDFAVRFVTHYYISKKEIEKTLDAIEKIVRQF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatagatttgagaagcgatacagtaactcttccaacacaagaaatgcgagaa
gctatgtataaagctgaggtaggtgatgacgtctacggcgaagaacctacagtgagaaaa
cttgaagaaatggcagcagaaatgttgggaaaagaagcagcaatgctagtaacaagcggt
acacaaggtaaccaagtctcaataatgactcacactcatccaggagaagaaattattgta
gaagaaaactgccatatcataacttatgaagttggaggagtgggataccttgcaggcgta
cagacaaaagctttgaaaagcaacaaaggtgtcttaaatcctgccgatgtagaaaaggcc
ataaggccaaaggacatacattaccccgtcacaagtcttatctgccttgaaaatactcat
aacagagctggtggcactgtaactccaattgaaattatgaaggaaatatacgaaatagct
caaaaacataatatacctgttcatttagatggtgcgagaatattcaatgccgctacttat
cttaaagtagatgtaagagaaatagccaaatatgcagatagtgtaatgttttgcctctcc
aaaggcttatgcgcccctattgggtcggtagtcgtcggcacaaaagatttcattgaaaaa
gcaagaaaataccgcaaaatgttaggtggtggaatgagacaagcaggttttattgcagct
gctggcattgtagcacttgaaaaaatgacaaaaaggctacaggaagaccatgacaatgca
agatttttagcagaaggattaaaaaatataccgggaataaacctcgacctggaaacagtg
cagactaatattgtaatgacagacatttcaggcacaggaatgacaggtaaggaactatcc
ttaagactaaaagagcatggaattttaataaacgacgggaatgattttgcagtaagattt
gtaactcattattacataagtaaaaaagagattgaaaaaactctcgatgcaattgagaaa
attgtaagacagttttag

DBGET integrated database retrieval system