KEGG   Thermofilum pendens: Tpen_0004Help
Entry
Tpen_0004         CDS       T00446                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
tpe  Thermofilum pendens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 Sugar_tr TRI12 OATP
Motif
Other DBs
NCBI-ProteinID: ABL77414
UniProt: A1RW34
Position
3025..4311
Genome map
AA seq 428 aa AA seqDB search
MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGKSEVEWRFNAGLIATL
LQGTGLVLSFVWGVLADKVGRRPVIFTLGVIMGLGLLLVSQARSYAELLAYFIAFGVGYV
GVGPAIYAFISDALPSESRGRGYASYYVSSVLAMILGLIVAGVLLPWRTAYMLAGLLTLV
FSVLLFYSSRGIFIGYSEKGAREARRYSLRESLPSLRKKSVLLVLLMIIPWTIPWGMLSI
WSIDYISTKWGVSTGTASLIIAAATASIALGHIVGGTLSDRLAGKGDYTGRTKVSLLGVV
VGYVSMMLMVTYPYPYGSTNFKDLLVPSALAVGGMMFTTFAYPNINTVLSEVVVPEHRGT
VFAVYSVLNNLGWTLGPTVYTLLLKAFSGVYADQVSAMTAAASTIVSLWLIPALCWLLLH
RVYPKEKI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccggagggaagacccagggttaaagtcatagtagcctccctagcgctcttcgtgctc
ttctacttcatggggtactacatgcttaacccgatactgcgaacgttgcacgcagagggg
ctcattcccgggaaaagcgaggtcgagtggcgcttcaacgccgggcttatagccacgcta
cttcaaggaacgggcctcgtcctctcgttcgtgtggggagtgctcgccgacaaggttggt
aggcgcccagtgattttcacgcttggagtaataatggggttagggctactcctggtgtcg
caggctaggagctacgccgagctactcgcctacttcatcgcgttcggcgtgggatacgtg
ggcgtgggaccagcgatatacgcctttatctccgacgccctgcccagcgagagcaggggg
agaggttacgcgtcctactacgtctcaagcgtgctcgccatgatcctagggctgatagtc
gccggcgtactcctgccgtggcgcacagcctacatgcttgcaggactactcacactggtg
ttctccgtcctcctgttctactcttcgaggggcatattcatagggtactcggagaaaggc
gctagagaggctaggaggtactcgctcagagaatccctgccgagcctgaggaagaaaagc
gttctgctcgtactcctaatgatcataccctggaccatcccttggggtatgctgagcata
tggtccatagactacattagcacgaagtggggcgtctcgactggtacagcgtcgctgata
atagcggcggcgactgcttcgatagctcttggacacatagtgggcggcaccctgagcgat
aggctcgccggcaagggggactacaccgggagaacaaaggtgtcgctactgggagtagta
gtcgggtacgtgtcgatgatgctcatggtaacatacccctacccctacggcagtacgaac
tttaaagacctccttgtaccctcagcgctagcagttggcggaatgatgttcaccacgttt
gcgtacccgaatataaacaccgttctaagcgaggtggtagtcccggagcatagaggcacg
gtgttcgctgtttacagcgttctaaacaacctgggctggaccctgggcccaacggtctac
actcttctcctcaaggcattcagcggcgtctacgcagaccaagtatcggcgatgaccgcg
gcagcgtcgacgatagtctccctgtggctcatacctgcactttgctggctactgctccac
agggtctacccgaaggagaagatatag

DBGET integrated database retrieval system