KEGG   Thermofilum pendens: Tpen_0543Help
Entry
Tpen_0543         CDS       T00446                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
tpe00010  Glycolysis / Gluconeogenesis
tpe00020  Citrate cycle (TCA cycle)
tpe00620  Pyruvate metabolism
tpe00633  Nitrotoluene degradation
tpe00640  Propanoate metabolism
tpe00650  Butanoate metabolism
tpe00680  Methane metabolism
tpe00720  Carbon fixation pathways in prokaryotes
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
tpe01130  Biosynthesis of antibiotics
tpe01200  Carbon metabolism
Module
tpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0543
   00020 Citrate cycle (TCA cycle)
    Tpen_0543
   00620 Pyruvate metabolism
    Tpen_0543
   00640 Propanoate metabolism
    Tpen_0543
   00650 Butanoate metabolism
    Tpen_0543
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0543
   00680 Methane metabolism
    Tpen_0543
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0543
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABL77949
UniProt: A1RXL9
Position
492997..493899
Genome map
AA seq 300 aa AA seqDB search
MSHKAFPREEYILKGHAACPGCGATLLLRHVLKALGPNTYLVIPACCTSVIAGPHPRSAF
KVPVLHIAFAASAAAASGMVEALEKLGKPANVVVWAGDGGTVDIGLQALSGAAERGHNLI
YICYDNEAYMNTGIQKSGSTPYKAWTTTTPTGNLSVKKDVPSIMVAHRVPYVATINPAYV
NDLYYKLRKAAQIKGGLKYIHAFSPCPVGWRYDSSLTVKVARLAVETGVWVLYEVENGMF
SLTGPSKALVDKSKRKPVAEYLRLQGRFSHLKEEDIAEIQRLVDEQWERIAEILREQEKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaaggccttcccgcgggaggagtacatactgaaggggcacgccgcgtgccct
ggttgcggcgcgacactgctactgcggcacgtactgaaagcccttggacccaacacgtac
ctggttatcccggcctgttgtacgagcgtgatagcgggaccacaccctaggtctgcgttc
aaggtgccggtgcttcacatagcgttcgctgcaagcgccgctgccgcatcaggcatggtg
gaggcgttggagaagctcgggaagcctgcgaatgtcgtcgtgtgggccggggacggcggg
acggtggacataggactccaggccttgagcggtgcggcggagagaggacacaacctcatc
tacatatgctacgacaacgaggcctacatgaacacggggattcagaagtcagggtccact
ccctacaaggcttggaccacgacgactcccactgggaatctgagtgtaaagaaagacgta
ccgtcgatcatggtggcgcaccgcgtcccctacgtggctacgataaaccctgcctacgtg
aatgacctctactacaagcttagaaaggcggcgcagataaagggagggttaaagtatatc
cacgcgttctccccctgccctgtcgggtggaggtacgactccagcttaacggtcaaggtt
gcccgcctagccgtagagactggggtgtgggttctctacgaggttgagaacggtatgttc
agccttacgggacccagcaaggccttagtagacaagagcaagaggaagcccgtcgcggag
tacttaaggcttcaggggaggttctcgcatcttaaggaggaggacatcgccgagattcaa
agactcgttgacgagcaatgggagagaatcgcggagatactacgggagcaggagaagggc
tag

DBGET integrated database retrieval system