KEGG   Thermofilum pendens: Tpen_0602Help
Entry
Tpen_0602         CDS       T00446                                 

Definition
(GenBank) CoA-binding domain protein
  KO
K01905  acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
tpe  Thermofilum pendens
Pathway
tpe00010  Glycolysis / Gluconeogenesis
tpe00620  Pyruvate metabolism
tpe00640  Propanoate metabolism
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0602
   00620 Pyruvate metabolism
    Tpen_0602
   00640 Propanoate metabolism
    Tpen_0602
Enzymes [BR:tpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Tpen_0602
Lipid biosynthesis proteins [BR:tpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tpen_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding Ligase_CoA CPSase_L_D2 ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ABL78007
UniProt: A1RXS7
Position
556017..558131
Genome map
AA seq 704 aa AA seqDB search
MIDERILRLLRPESVAVVGASRNPEKIGYQVVKNLLEAGFPRERIFPVNPNADEILGLKC
YKSVSEIPYQVDLVVVAVPAPAVPGVLEDAGRKGVKAVAVITSGFKEIGNVDLEQRIASI
AKNYGMRLLGPNIVGICDTVKRVNASFCQGLPKPGEIAFITQSGALGIALVGWTKLKGIG
LSDLVSIGNKADVDETDLVEFFGEDQYTKVITAYLEGVSDGRRFLEAARRVARRKPIIVL
KAGRGVRTIGAIKSHTGSLAGSFAAYEAAFKQSGILLARSFVELFDWATAFAKTHIPRGE
NVVVLTNGGGAGIMATDALEDYGIRLMDIPQDLAEKLRKHMPPFGSVFNPVDLTGMADAE
QYYGALKDLLMHDSVDAVLVLYCHTAITNPQEIAEALLRAVRETESKKTVLASFIGGEEV
NEACGKLTENGIPCYESPEKAASSLGAIYRYKHMLEKLDRRTEVAVSVDVEAARHVVRSA
LKEGRTTLTPSEAAALVGYYGIPVLAKKIAKSPEEAVRIAREIGYPVVLEVESPDILHKS
DIGGILVGLQSDAEVAEGYSKILDNVSKKAPSARVNGIIVRKMAEKGKEIALGVHRDPIF
GPLVMVGSGGVLVELYRDVSFRVAPLSLEDAYEMLEETKIYKVLKGYRGEPPSDYEKVVD
VLIRLSKLACDVEEIEDIDINPFFVYERGKGGIAVDVKVTLVQR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgaacgtatcttgaggcttttaaggccggagagcgtagctgttgttggcgcg
tcgcggaatcccgagaagataggctaccaggtcgttaagaacctcttggaggcagggttc
ccgcgggagagaattttccccgtaaatcccaatgccgacgagatactgggcttgaagtgc
tataaatccgtctcggagataccttaccaggtcgacttggtggttgtcgcggtcccagcc
cccgccgttccgggagttctagaggacgctggtcgaaagggtgttaaggcagttgccgta
ataacgagcggcttcaaggaaattgggaacgtagacttggagcaacgcatagcgagcata
gcgaagaactacgggatgagactcctaggcccgaacatagtcgggatatgcgacaccgtg
aagagagtaaatgcaagcttctgtcaagggctacctaaaccgggggagatagccttcatt
acgcagagcggagcactgggaatagcgctggtagggtggacgaagctgaagggcataggg
ctctccgacctggtcagcataggcaacaaagccgatgttgatgagacagaccttgtagag
tttttcggggaagaccagtacaccaaggttataaccgcatacctggaaggggtgagcgac
gggagaaggttcctcgaggctgcacgccgcgtagcgaggcggaagccaataatcgtactc
aaggcgggtagaggtgtaagaaccataggcgccatcaaatcgcacacgggttcgcttgca
gggagcttcgcagcttatgaggcggcgttcaagcagtcgggtatcctgcttgcgcgtagc
ttcgtagagctcttcgactgggcgactgctttcgcgaagacgcacattccgagaggggag
aacgtcgttgtgcttacgaatggcggaggagcgggtataatggcgaccgacgcgttggaa
gactatggaatcaggctgatggacataccccaggacctagccgagaagctgaggaagcac
atgccgcccttcgggagcgtcttcaaccccgtagacctcacgggcatggcagacgcggaa
cagtactacggcgcgctcaaagacctgttgatgcatgactctgtggacgccgtgctggta
ctctactgccacacagccataacgaacccacaggagatagcggaagcgctactaagggct
gtccgggagacggaaagcaagaagacagttcttgcgtcgttcataggcggcgaagaggta
aacgaggcgtgcgggaagcttaccgaaaacggtattccgtgctacgagtcgcccgagaag
gcggcgtccagcctgggcgccatctacaggtacaaacacatgctcgaaaaactcgacagg
aggaccgaggtagccgtaagcgttgacgtcgaagctgcgcgccacgtggttaggagcgcc
ttgaaggaggggagaacgacgctaacgccctcggaggccgcggcgctggtcgggtactat
gggatcccggtcttagcgaagaagatcgctaaaagccccgaggaagcagtgaggatagcg
cgagagatcgggtaccccgtggttctcgaggtggagtcccccgacatcctccataaaagc
gacatcggcggtatactggtagggcttcaaagcgacgccgaggtagccgaggggtacagc
aagatactcgacaatgtatccaagaaagctcccagcgccagggttaacggtatcatcgtt
aggaagatggcggagaaaggcaaggagatagcactgggcgtgcacagagaccccattttc
ggaccgctggtaatggtaggctccggaggagtcctcgtggagctctacagggatgtgagc
ttccgcgtagctcccctgagcctggaggacgcctacgaaatgctcgaagagacgaagatc
tacaaggtgctcaaaggatacagaggagaacccccctccgactacgaaaaggttgtcgac
gttctgataaggctgtcaaaactcgcctgcgacgtagaggagatcgaggacatagacatc
aacccgttcttcgtatacgagagagggaaaggagggattgcggtagacgtcaaagtaacc
ctcgtacagcgctag

DBGET integrated database retrieval system