KEGG   Thermofilum pendens: Tpen_1227Help
Entry
Tpen_1227         CDS       T00446                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tpe  Thermofilum pendens
Pathway
tpe00630  Glyoxylate and dicarboxylate metabolism
tpe01100  Metabolic pathways
tpe01110  Biosynthesis of secondary metabolites
tpe01120  Microbial metabolism in diverse environments
tpe01130  Biosynthesis of antibiotics
tpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tpen_1227
Enzymes [BR:tpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Tpen_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N 4HFCP_synth Glyco_trans_4_3
Motif
Other DBs
NCBI-ProteinID: ABL78625
UniProt: A1RZJ5
Position
1164846..1166177
Genome map
AA seq 443 aa AA seqDB search
MPEEFEPYGEFVVKSYLPDPDKDVIVTFRVTPSEGFTIEDAAGGVAAESSVGTWTTLYQW
YDKSRIDRLKGKAYYMESLGDGSYILRVAYPVELFEEGNMPAFLASVAGNIFGMRRVRSL
RVEDIYLPEAFLKHFKGPSQGVEGVRGKLKIWGRPIIGTVPKPKVGYSPEEVEKLAYEIL
VGGMDFVKDDENLAGPSYCRFEERAKAIMKAIDRAEKETGERKAWLANITADVREMERRL
KLVAELGNTHVMVDVVIAGWSSLTYVRDLAADYKLAIHGHRAFHAAFTRNPYHGVSMFTL
AKLYRIIGVDQLHVGTPEVGKLEAKAVDVIRMARLLREQTYKPDIEDGLHMQQPFPGIKP
AFPVSSGGLHPGTLPAVIKAMGVDTVIQVGGGVVGHPDGPRAGAAAARQAVEAYLEGVPL
QEYAKTHRELARALEKWGQVIPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagagtttgaaccttacggcgaatttgtggtcaagagctacctgccggatccc
gataaagacgtcattgtcacatttagggttactccgagcgagggcttcacaatagaggac
gcagcgggaggcgtagccgcggagagcagcgtcggcacgtggactaccctgtaccagtgg
tacgataagagcaggatcgacaggctcaaggggaaggcttactacatggagagcctgggc
gacgggtcatacatcctccgggtcgcgtaccccgtcgagctgttcgaagaggggaacatg
ccggccttcctggcgtccgttgccggcaacattttcggcatgaggagggtccgctccctg
agggttgaggacatatacttgcccgaagccttcctgaagcacttcaagggcccctcgcag
ggcgtcgagggtgtacgcgggaagctgaagatctgggggaggcccataataggcaccgtg
ccgaagccgaaggtcgggtactcccccgaggaggtcgagaagctggcctacgagatactg
gtcgggggcatggacttcgtgaaggacgacgagaacctggcgggcccgagctactgcagg
ttcgaggagagggctaaggcgataatgaaggcgatagacagggccgaaaaggagacgggc
gagaggaaggcctggctcgccaacataacggcggacgtcagggagatggagcgcaggctt
aagcttgtagcggagctcggcaacacgcacgtcatggtcgacgtggtgatagcgggctgg
tcctccctgacgtacgtaagggatctagccgcggactacaagctggcgatacacgggcac
agggctttccacgccgccttcacccggaacccctaccacggtgtatcgatgttcaccctc
gcgaagctgtacaggataatcggcgtcgaccagctacacgtagggacaccggaggtcggc
aagctggaggcgaaagccgtagacgtgatcaggatggcgcgcctactcagggagcagacg
tacaagccagacattgaggacgggctccacatgcagcaaccattccccgggataaagccg
gctttccccgtctccagcggaggcctccacccgggcacgctacccgctgtcatcaaggct
atgggcgtagacaccgtcatccaggttggagggggcgttgtagggcaccccgacggaccg
agggcgggcgccgccgcggctaggcaggctgtagaagcgtacctcgagggagtcccgcta
caggagtacgcgaagacgcacagagagcttgcaagagccctcgagaaatgggggcaagtg
atacccgtctag

DBGET integrated database retrieval system