KEGG   Thermofilum pendens: Tpen_1537Help
Entry
Tpen_1537         CDS       T00446                                 

Definition
(GenBank) threonine synthase-related protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tpe  Thermofilum pendens
Pathway
tpe00260  Glycine, serine and threonine metabolism
tpe01100  Metabolic pathways
tpe01110  Biosynthesis of secondary metabolites
tpe01120  Microbial metabolism in diverse environments
tpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpen_1537
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tpen_1537
Enzymes [BR:tpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tpen_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL78933
UniProt: A1S0F3
Position
1484901..1485878
Genome map
AA seq 325 aa AA seqDB search
MEEGDSSSSKLLALSTPLLKLTSLRKLLNLDGAAVYLKYEGYNPTGTHKDRAALAHVGEA
VLNGYDTVTVGTCGNYGVAVAYYARLAGLRAVIFVPKGYSNSRVPEMKRYGARVVEVEGP
YEDAVAVSVSSARANGWYDANPGSVNDHVSIEAYSLIAREIVRQLGDAPAVVAVPVGNGT
TLVGIYHGFYRLYRAGETTRIPRMVAASTSNANQLVYSWSRGSTEPLPVEVSEVRETPVN
EPLVAIRSLNAEEALRAIYASKGAAFGFSDSEMVEMSILLRAFEGVSALPASASALLAVR
EYLKANEVDGPVVAVITGRWRREKR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggaggagggagactcatctagtagtaaacttttagcgctctcaacccccctgctcaag
ctcacatctctcaggaagcttctcaaccttgacggcgccgctgtctacttgaagtacgag
ggctacaaccccacgggtacgcacaaggacagggctgccctcgcgcacgtgggagaggcc
gttctcaacggctacgacacggtgacggtcgggacctgcggtaactacggcgtcgcggta
gcgtactacgctaggctcgcggggcttagggcggtgatattcgtcccgaagggctacagc
aacagtagggtgccggagatgaagaggtacggggcgcgtgtagtggaggtggaggggccc
tacgaggacgcggtcgcggtaagcgtgagctccgcaagggctaacgggtggtacgacgcg
aaccccggtagcgtgaacgaccacgttagcatagaggcttactccctcatagcgagggag
atcgtgaggcagctcggagacgcccctgccgtagtggctgtacccgtggggaacggaacc
acgctcgtagggatataccacggcttctacaggctgtacagagccggggagactacgagg
atcccgaggatggtcgctgccagcacgtccaacgcgaaccagctcgtctactcctggagc
agggggtcgacggagcccctaccggtcgaggtctccgaggtgcgcgaaaccccggtgaac
gagccgctcgtcgcgattaggtcgctgaacgccgaggaggctctgagagctatatacgcg
tctaagggcgcggcgttcggcttcagcgactccgagatggtcgagatgtcgatactcctc
agggcgttcgagggggtaagcgctctacccgcgtcggcgtccgcgctcctggctgtacgc
gagtaccttaaggcaaacgaggtcgacggcccggtagtagcggtgataacggggagatgg
aggagggagaagcggtaa

DBGET integrated database retrieval system