KEGG   Thermococcus peptonophilus: A0127_01265Help
Entry
A0127_01265       CDS       T04728                                 

Definition
(GenBank) sodium:phosphate symporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tpep  Thermococcus peptonophilus
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A0127_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 SBF
Motif
Other DBs
NCBI-ProteinID: AMQ17896
UniProt: A0A142CSZ4
Position
253166..254086
Genome map
AA seq 306 aa AA seqDB search
MLMMLIATAVFMAWAIGANDSAKAVGTAVGSGILGFKRAVLLIGVFVFIGAFLGGSGVSN
TVSGLARGMEPVTIGLVLFSAAITVTLASLWGNPISTTQAIIGALVGATLAEGLPVDWPV
VGKIVLTWIISPALAGVLAVGTYIPYKHLLNRIKHLGLLELTQKWLAFTASAYASFNLGA
NELANVIGLADGGSGVKGLLAIALGIGALTFSYEVMMTVGRDLAPLGPTSGFSAQMGAAL
AVTLANLFGIPVSSGQAIVGAISGVSLYKGEKLNKKALKGILRGWVTAPTASGVLAFILV
SLFSSF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgatgctgatagcgacagcggtcttcatggcttgggcgataggcgcgaacgac
agcgcaaaggcagttggaaccgccgtgggctccgggatactgggcttcaagagggcagta
ctcttaataggagtcttcgtgttcattggggcatttctcggtggttcgggggtctccaac
accgtgagtgggttagccaggggcatggaaccagtaaccattggactcgtcttattcagc
gctgccattaccgtaacattggccagcctctggggaaaccccatatccaccactcaggca
ataataggggccctcgttggggctaccctcgcggagggccttccagtggactggcccgtt
gttggaaagatagtgctaacctggatcatctctcccgccctagctggagttctggccgta
gggacatacatcccgtacaagcacctcctcaacaggataaagcacctcggacttcttgag
ctgacacagaagtggctcgcctttaccgcctcggcctacgcctccttcaacctcggggca
aacgagctcgccaacgtgataggactggcagacggaggatcgggggttaagggtctcctc
gcaattgcccttggaattggggcgctgacgttcagctatgaagttatgatgactgtggga
agggacctggccccactaggcccgacttcggggttttcggcccagatgggcgcggccttg
gccgttaccctggccaaccttttcggaatccctgtcagctctggacaggctatcgtcggc
gcaatatctggtgtgagcctgtacaagggcgagaaactcaacaaaaaggccctgaaaggt
attctgcgcggctgggttacggctccaacggcttccggtgttctcgcttttatcctcgtt
agcctgttctcttccttttga

DBGET integrated database retrieval system